DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG2 and dpr5

DIOPT Version :9

Sequence 1:NP_055127.2 Gene:VSIG2 / 23584 HGNCID:17149 Length:327 Species:Homo sapiens
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:256 Identity:56/256 - (21%)
Similarity:85/256 - (33%) Gaps:75/256 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    37 LGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTV 101
            ||.||.|.|.. ..:||. |:.|                           .:.:.:.:|    |:
  Fly   104 LGTTARLHCRV-RHLGDR-AVSW---------------------------IRQRDLHIL----TI 135

Human   102 GVAT-------------------LKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSN 147
            |:.|                   ||:..|...|.|.|.|||:..|....    ...|.|:...:.
  Fly   136 GIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISL----AYKLVVVTSKAQ 196

Human   148 PLCSQSGQTSVGGSTALRCSSSEGAPKPVYN--WVRLGTFPTPSP--GSMVQDE---VSGQLILT 205
            .|.::......|....|.|.:.: ||.|..:  |.:.....:.|.  |..|:.|   .:..|:::
  Fly   197 ILANRELFIQSGSDINLTCIAPQ-APGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVIS 260

Human   206 NLSLTSSGTYRCVATN-QMGSASCELTLSVTEPSQGRVAGA----------LIGVLLGVLL 255
            .:..|.||.|.|.|.| ...|....:..|....:.....|:          |:.|||.|||
  Fly   261 RVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQHELGSRLLLPPLPLLLLAVLLVVLL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG2NP_055127.2 V-set 31..142 CDD:311561 25/123 (20%)
Ig 164..231 CDD:319273 19/74 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
dpr5NP_650080.3 V-set 95..191 CDD:284989 25/123 (20%)
IG_like 98..179 CDD:214653 23/107 (21%)
IG_like 206..278 CDD:214653 19/72 (26%)
Ig 211..278 CDD:143165 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.