DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG2 and dpr16

DIOPT Version :9

Sequence 1:NP_055127.2 Gene:VSIG2 / 23584 HGNCID:17149 Length:327 Species:Homo sapiens
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:212 Identity:46/212 - (21%)
Similarity:70/212 - (33%) Gaps:63/212 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    38 GKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVG 102
            |.....|.|...::|:|||                        |..|.|.:....|.|.      
  Fly   269 GGALSTTATPVAALGNSFA------------------------HAVPGGQERGNSSSLS------ 303

Human   103 VATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRC- 166
             .||::..|:..|.|.|.||:...|.....    :.|.|:.|.:..:..:......|....|.| 
  Fly   304 -WTLQIKYVNLEDAGWYECQLATEPKMSAK----VQLFVI
TPRTELIGDRQRFVKAGSRVELHCI 363

Human   167 -SSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCEL 230
             ..:..|||.:: |.|.....|      .::|.||         ..||.|..:..|..||     
  Fly   364 VRGTLEAPKYIF-WYRGDQQVT------AENEASG---------AQSGWYTQIDRNIFGS----- 407

Human   231 TLSVTEPSQGRVAGALI 247
                ||.::..: |:|:
  Fly   408 ----TEHNRNTI-GSLV 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG2NP_055127.2 V-set 31..142 CDD:311561 22/103 (21%)
Ig 164..231 CDD:319273 17/68 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 22/102 (22%)
Ig <298..338 CDD:299845 12/50 (24%)
IG_like 352..447 CDD:214653 22/94 (23%)
Ig 358..439 CDD:143165 21/88 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.