DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG2 and dpr13

DIOPT Version :9

Sequence 1:NP_055127.2 Gene:VSIG2 / 23584 HGNCID:17149 Length:327 Species:Homo sapiens
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:244 Identity:51/244 - (20%)
Similarity:84/244 - (34%) Gaps:78/244 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    33 LSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTG----SKSKRVS 93
            ::|.:|.||.:.||.. .:|:. .:.|               :...:.||...|    |..:|.|
  Fly   185 VTTQIGATAHVPCTVH-HIGEG-VVSW---------------IRKKDYHLLTVGLTTYSSDERFS 232

Human    94 L--LQNPPTVGVATLKLTDVHPSDTGTYLCQVN-NPPDFYTNGLGLINLTVLV--PPSNPLCSQS 153
            .  |::...   .||::..|...|.|.|.|||: :||......|.::.....:  ||...|    
  Fly   233 ATHLKHSED---WTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYL---- 290

Human   154 GQTSVGGSTALRCSSSEGAPKPVY----------NW-----VRLGTFPTPSPGSMVQDEVSGQLI 203
               :.|.:..|:|...:......|          |:     :.:.|.|         |..|.:|.
  Fly   291 ---TPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEP---------DFQSSELT 343

Human   204 LTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAGALIGVLLG 252
            :.......||.:.|||:|             |:|     |..|:.:..|
  Fly   344 IQRTRREHSGNFTCVASN-------------TQP-----ASVLVHIFKG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG2NP_055127.2 V-set 31..142 CDD:311561 27/115 (23%)
Ig 164..231 CDD:319273 15/81 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
dpr13NP_001033956.2 V-set 180..276 CDD:284989 27/110 (25%)
IG_like 182..262 CDD:214653 23/96 (24%)
IG_like 285..362 CDD:214653 19/105 (18%)
IGc2 292..361 CDD:197706 15/77 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.