DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG2 and side-V

DIOPT Version :9

Sequence 1:NP_055127.2 Gene:VSIG2 / 23584 HGNCID:17149 Length:327 Species:Homo sapiens
Sequence 2:NP_611765.2 Gene:side-V / 37679 FlyBaseID:FBgn0085400 Length:1174 Species:Drosophila melanogaster


Alignment Length:340 Identity:77/340 - (22%)
Similarity:121/340 - (35%) Gaps:92/340 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    32 PLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISES-HPILYFTNGHLYPTGSKSKRVSLL 95
            |.:...|..:|:.    |:||...||....| ||..|.:. ..::::..|::.|..:...|    
  Fly    33 PATADEGPLSEIL----TAVGSEVALPCDLV-PGTGIVDKVQLVIWYRQGNVKPIYTFDAR---- 88

Human    96 QNPPTVGV--------------------ATLKLTDVHPSDTGTYLCQVNNPPDFYTNGL--GLIN 138
            ..|..:|:                    ..|::.::..||.|.|.|:|    ||:.:..  ..||
  Fly    89 GRPLNLGIPWADESVFNKKAHFHHDTDPPALRIKNIQTSDAGLYKCRV----DFHKSPTRNWRIN 149

Human   139 LTVLVPPSN-PLCSQSG-----QTS----VGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSM 193
            :||||||:. .:....|     ||:    .|.|..|.|.||.|.|.|..:|.|            
  Fly   150 VTVLVPPTALTILDHHGAEIRDQTAGPYLEGDSIDLTCLSSGGVPPPRVSWWR------------ 202

Human   194 VQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAGALIGVLLGVLLLSV 258
                 ...||..:..:...|:.|.|...:.......||:...:.|.|.|..||...::..:.|..
  Fly   203 -----EHALIDDSFQVLPDGSVRNVLRLKNIQRKDLLTMYTCQASNGHVVPALTKKVILDMNLPP 262

Human   259 AAFCLVRFQKERGKKPKETYGGSDLREDAIAPGISEHTCMRAD---------SSKGFLERPSSAS 314
            .:..|                 ..|....||...|..||....         |..|.:.|.:::|
  Fly   263 LSLLL-----------------QGLNHAVIAGTRSHVTCTAIGARPPPEIIWSKAGQIVRGATSS 310

Human   315 TVT---TTKSKLPMV 326
            |.:   ||.|:|.::
  Fly   311 TSSDGNTTISELMLI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG2NP_055127.2 V-set 31..142 CDD:311561 29/132 (22%)
Ig 164..231 CDD:319273 14/66 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 8/25 (32%)
side-VNP_611765.2 Ig 42..153 CDD:299845 27/123 (22%)
IG_like 42..152 CDD:214653 26/122 (21%)
IGc2 179..245 CDD:197706 19/82 (23%)
IG_like 179..245 CDD:214653 19/82 (23%)
Ig <282..348 CDD:299845 11/44 (25%)
IGc2 400..459 CDD:197706
FN3 719..798 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.