DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG2 and dpr18

DIOPT Version :9

Sequence 1:NP_055127.2 Gene:VSIG2 / 23584 HGNCID:17149 Length:327 Species:Homo sapiens
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:395 Identity:85/395 - (21%)
Similarity:128/395 - (32%) Gaps:166/395 - (42%)


- Green bases have known domain annotations that are detailed below.


Human    28 VPTE------PLSTP--------------LGKTAEL-TCTYSTSVGDSFALEWSFV-QP------ 64
            :||:      |:.||              :|.|.:| |.|..|:...|..::.|.: ||      
  Fly   125 IPTKMSRGKIPMETPGSMEFSSNSLPIKNVGTTDQLTTVTMPTTAFASLKVDRSTMKQPIDSTRT 189

Human    65 -------------GKPISESH-----------PILYFTNG-------HLYPTGSKSKRVSLLQNP 98
                         .:|.|:.|           ||...|:|       ||:.....:.||.:|::.
  Fly   190 RNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDK 254

Human    99 P--------------TVGVAT------------------LKLTDVHPSDTGTYLCQVN-NPPDFY 130
            .              |||..|                  |.:......|.|.|:|||: :||..:
  Fly   255 TVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVF 319

Human   131 TNGLGLINLTVLVPPSNPLCSQSGQTSVG------GSTA-LRC---------------SSSEGAP 173
            |.     |||||.||...:  ...:..||      |||. |:|               .|::.|.
  Fly   320 TT-----NLTVLEPPLRII--DEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSAN 377

Human   174 KPVYNWVRLGTFPTPSPGSM--VQDEVSGQ--------------------------LILTNLSLT 210
            ..|...:...|......|::  .|.:.|||                          |.::::.||
  Fly   378 DAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLT 442

Human   211 SSGTYRCVATNQMGSASCELTLSVTEPSQ-----GRVAGAL---IG--------VLLGVLLLSVA 259
            |..:......:..|:.||.|....|...|     |.:..|:   ||        .:||.||:.:.
  Fly   443 SRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQHNIGSRTEIYSLAMLGHLLVLIF 507

Human   260 AF-CL 263
            .| ||
  Fly   508 LFTCL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG2NP_055127.2 V-set 31..142 CDD:311561 42/202 (21%)
Ig 164..231 CDD:319273 18/109 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
dpr18NP_573102.1 IG_like 242..325 CDD:214653 19/87 (22%)
Ig <258..326 CDD:299845 17/72 (24%)
IGc2 <417..461 CDD:197706 6/43 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.