DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG2 and dpr8

DIOPT Version :9

Sequence 1:NP_055127.2 Gene:VSIG2 / 23584 HGNCID:17149 Length:327 Species:Homo sapiens
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:338 Identity:61/338 - (18%)
Similarity:115/338 - (34%) Gaps:88/338 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    14 LGFLCLSGLAVE-----------VKVPTEPLSTP-------------LGKTAELTCTYSTSVGDS 54
            ||.|||.....:           ..:||.....|             :|||.:|||... ::|:.
  Fly     9 LGILCLLAGCTDGASKRFFTDFLQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVK-NLGNR 72

Human    55 FALEWSFVQPGKPISESHPILYFTNGHLYPTG----SKSKRVSLLQNPPTVGVATLKLTDVHPSD 115
             .:.|               :...:.||...|    :..:|...:.:|.... .||::......|
  Fly    73 -TVSW---------------VRHRDIHLLTVGRYTYTSDQRFEAMHSPHAED-WTLRIRYAQRKD 120

Human   116 TGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRC-SSSEGAPKPVYNW 179
            :|.|.||::..|....:    :.|.::.|.::.:.......:.|.:..|.| ......|.|...|
  Fly   121 SGIYECQISTTPPIGHS----VYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIW 181

Human   180 V---RLGTFPTPSPG-SMVQDE---VSGQLILTNLSLTSSGTYRCVATN------QMGSASCELT 231
            .   .:..|.:|..| |:|.::   .:.:|::.......||.|.|..:|      ::.....|..
  Fly   182 SHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHP 246

Human   232 LSVTEPSQGRVAGALIGVLLGVLLLSVAAFCLVR------------------------FQKERGK 272
            .::...:.|....:...|||.::||:.:...|::                        |.:|:..
  Fly   247 AAMHTGNNGNSTASQPPVLLPLVLLTCSTLMLLQLVASCSTLVPATPPGCRTVQQASTFAEEKAM 311

Human   273 KPKETYGGSDLRE 285
            ..:......||:|
  Fly   312 GQRSNRNCQDLQE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG2NP_055127.2 V-set 31..142 CDD:311561 23/127 (18%)
Ig 164..231 CDD:319273 17/80 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 20/97 (21%)
V-set 52..143 CDD:284989 22/112 (20%)
IG_like 153..238 CDD:214653 17/84 (20%)
ig 153..232 CDD:278476 17/78 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.