DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG2 and dpr1

DIOPT Version :10

Sequence 1:NP_055127.2 Gene:VSIG2 / 23584 HGNCID:17149 Length:327 Species:Homo sapiens
Sequence 2:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:392 Identity:76/392 - (19%)
Similarity:122/392 - (31%) Gaps:136/392 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    13 LLGFLCLSGLAV-----EVKVPTEP-----------------------LSTPLGKTAELTCTYST 49
            |:|:|.|..:.:     ....||.|                       |:..:|:|..|.|... 
  Fly    15 LIGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVE- 78

Human    50 SVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPS 114
            .:||. .:.|        |.:....:....|..|   :..:|..:|: |......||::....|.
  Fly    79 RLGDK-DVSW--------IRKRDLHILTAGGTTY---TSDQRFQVLR-PDGSANWTLQIKYPQPR 130

Human   115 DTGTYLCQVNNPPDF---YTNGLGLINLTV-LVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKP 175
            |:|.|.||:|..|..   ||  ..::.|.. :..||:.:      ...|....|.|...:| |..
  Fly   131 DSGVYECQINTEPKMSLSYT--FNVVELKAEIFGPSDLM------VKTGSDINLTCKIMQG-PHE 186

Human   176 VYN--WVRLGTFPTPSPG------SMVQ--------DEVSGQLILTNLSLTSSGTYRCVATNQMG 224
            :.|  |.: |:......|      ||.:        |.::.:|.:.......:|.|.||      
  Fly   187 LGNIFWYK-GSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV------ 244

Human   225 SASCELTLSVTEPSQGRVAGALIGVLLG----------------------VLLLSVAAFCLVRF- 266
                        |:..:.:...:.|::|                      .:|||:.:.||..| 
  Fly   245 ------------PTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQHFY 297

Human   267 -------------QKERGKKP--------KETYGGSDLREDAIAPGISEHTCMRADSSKGFLERP 310
                         .|..|..|        .||  |....|.|.|.|.|........:.....|||
  Fly   298 ETGCGYLHAAAALAKSAGLGPPKRATLTTSET--GISAAEVAAAAGASAAVASALATCNMLRERP 360

Human   311 SS 312
            ::
  Fly   361 AA 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG2NP_055127.2 V-set 31..142 CDD:462230 28/137 (20%)
Ig 152..232 CDD:472250 17/95 (18%)
Ig strand B 162..166 CDD:409353 1/3 (33%)
Ig strand C 176..180 CDD:409353 1/5 (20%)
Ig strand E 200..204 CDD:409353 1/3 (33%)
Ig strand F 214..219 CDD:409353 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 3/8 (38%)
dpr1NP_995908.2 Ig 53..138 CDD:472250 20/98 (20%)
Ig strand A' 63..65 CDD:409355 1/1 (100%)
Ig strand B 69..77 CDD:409355 3/7 (43%)
CDR1 77..83 CDD:409355 1/6 (17%)
Ig strand C 84..90 CDD:409355 2/13 (15%)
CDR2 93..109 CDD:409355 2/18 (11%)
Ig strand D 109..114 CDD:409355 1/5 (20%)
FR3 110..147 CDD:409355 12/37 (32%)
Ig strand E 119..125 CDD:409355 2/5 (40%)
Ig strand F 133..148 CDD:409355 6/14 (43%)
CDR3 148..160 CDD:409355 3/13 (23%)
IG_like 163..257 CDD:214653 20/119 (17%)
Ig strand B 174..178 CDD:409355 1/3 (33%)
Ig strand C 189..193 CDD:409355 1/3 (33%)
Ig strand E 226..230 CDD:409355 1/3 (33%)
Ig strand F 240..244 CDD:409355 1/3 (33%)

Return to query results.
Submit another query.