DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG2 and dpr1

DIOPT Version :9

Sequence 1:NP_055127.2 Gene:VSIG2 / 23584 HGNCID:17149 Length:327 Species:Homo sapiens
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:392 Identity:76/392 - (19%)
Similarity:122/392 - (31%) Gaps:136/392 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    13 LLGFLCLSGLAV-----EVKVPTEP-----------------------LSTPLGKTAELTCTYST 49
            |:|:|.|..:.:     ....||.|                       |:..:|:|..|.|... 
  Fly    15 LIGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVE- 78

Human    50 SVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPS 114
            .:||. .:.|        |.:....:....|..|   :..:|..:|: |......||::....|.
  Fly    79 RLGDK-DVSW--------IRKRDLHILTAGGTTY---TSDQRFQVLR-PDGSANWTLQIKYPQPR 130

Human   115 DTGTYLCQVNNPPDF---YTNGLGLINLTV-LVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKP 175
            |:|.|.||:|..|..   ||  ..::.|.. :..||:.:      ...|....|.|...:| |..
  Fly   131 DSGVYECQINTEPKMSLSYT--FNVVELKAEIFGPSDLM------VKTGSDINLTCKIMQG-PHE 186

Human   176 VYN--WVRLGTFPTPSPG------SMVQ--------DEVSGQLILTNLSLTSSGTYRCVATNQMG 224
            :.|  |.: |:......|      ||.:        |.::.:|.:.......:|.|.||      
  Fly   187 LGNIFWYK-GSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV------ 244

Human   225 SASCELTLSVTEPSQGRVAGALIGVLLG----------------------VLLLSVAAFCLVRF- 266
                        |:..:.:...:.|::|                      .:|||:.:.||..| 
  Fly   245 ------------PTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQHFY 297

Human   267 -------------QKERGKKP--------KETYGGSDLREDAIAPGISEHTCMRADSSKGFLERP 310
                         .|..|..|        .||  |....|.|.|.|.|........:.....|||
  Fly   298 ETGCGYLHAAAALAKSAGLGPPKRATLTTSET--GISAAEVAAAAGASAAVASALATCNMLRERP 360

Human   311 SS 312
            ::
  Fly   361 AA 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG2NP_055127.2 V-set 31..142 CDD:311561 28/137 (20%)
Ig 164..231 CDD:319273 16/82 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 3/8 (38%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 26/110 (24%)
IG_like 60..150 CDD:214653 24/103 (23%)
IG_like 163..257 CDD:214653 20/119 (17%)
Ig 174..244 CDD:143165 14/71 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.