DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP14 and Dcp-1

DIOPT Version :9

Sequence 1:NP_036246.1 Gene:CASP14 / 23581 HGNCID:1502 Length:242 Species:Homo sapiens
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:222 Identity:61/222 - (27%)
Similarity:105/222 - (47%) Gaps:28/222 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    11 KYDMSGARLALILCVT---------KAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELE 66
            :|:||.....:.|...         |:|.|:..|...|:..|..|.|..::.:|.......:.:.
  Fly    70 EYNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHVG 134

Human    67 KFQQAIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYIIQA 131
            |..:...:..|   |..|.:::||..|:|..:|.: .||:|::.......|.:|..|||::.|||
  Fly   135 KAAELDHTDND---CLAVAILSHGEHGYLYAKDTQ-YKLDNIWHYFTATFCPSLAGKPKLFFIQA 195

Human   132 CRGEQRDPGETV-------GGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQ 189
            |:|::.|.|.|:       .|:      ..:...||.:.|.|..|||:.||.::|:...||.::|
  Fly   196 CQGDRLDGGITLEKGVTETDGE------SSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQ 254

Human   190 TLVDVFTK--RKGHILELLTEVTRRMA 214
            :|:.....  :|..:|.|||.|.:|:|
  Fly   255 SLIRELNANGKKYDLLTLLTFVNQRVA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP14NP_036246.1 CASc 18..242 CDD:237997 58/215 (27%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 61/221 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.