DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP14 and Strica

DIOPT Version :9

Sequence 1:NP_036246.1 Gene:CASP14 / 23581 HGNCID:1502 Length:242 Species:Homo sapiens
Sequence 2:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster


Alignment Length:213 Identity:57/213 - (26%)
Similarity:104/213 - (48%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    29 REGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEKFQQAIDSREDPVSCAFVVLMAHG-RE 92
            |:||.:|:..|...|.||:.:..:..|.|....::.:...|  ....||. |...:|:::|| |.
  Fly   330 RKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQ--TKDFEDK-SALVLVILSHGTRH 391

Human    93 GFLKGEDGEMVKLEN--LFEALNNKNCQALRAKPKVYIIQACRGEQRDPGETVGGDEIVMVIKDS 155
            ..:..:|.: ..|::  :|..|.|:   .|:.|||:..:|||:|:.:     :||     .:.|:
  Fly   392 DQIAAKDDD-YSLDDDVVFPILRNR---TLKDKPKLIFVQACKGDCQ-----LGG-----FMTDA 442

Human   156 PQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQ 220
            .|...:..:.|..|||.||::::| .:.|:.|||||.:.. .|.|...::.|.:   |...::|:
  Fly   443 AQPNGSPNEILKCYSTYEGFVSFR-TEDGTPFIQTLCEAL-NRSGKTSDIDTIM---MNVRQVVK 502

Human   221 EGKARKTNPEIQSTLRKR 238
            .....:..|.:.|||..:
  Fly   503 MQSKDRQIPSVTSTLTSK 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP14NP_036246.1 CASc 18..242 CDD:237997 57/213 (27%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 57/213 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.