DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CASP14 and ced-3

DIOPT Version :10

Sequence 1:NP_036246.1 Gene:CASP14 / 23581 HGNCID:1502 Length:242 Species:Homo sapiens
Sequence 2:NP_001255708.1 Gene:ced-3 / 178272 WormBaseID:WBGene00000417 Length:503 Species:Caenorhabditis elegans


Alignment Length:244 Identity:69/244 - (28%)
Similarity:111/244 - (45%) Gaps:41/244 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    29 REGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEKFQQAIDSREDPVSCAFVVLMAHGREG 93
            |.|::.|.|.|.::||.:.:....|.:.|.......:..|.:    .|.....|.:|:::||.|.
 Worm   259 RNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAK----HESHGDSAILVILSHGEEN 319

Human    94 FLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPGETV-------------GG 145
            .:.|.|...:....:::.||..|...|..|||:..:||||||:||.|..|             |.
 Worm   320 VIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGW 384

Human   146 DEIVMVIKDSP------------QTI----PTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDV 194
            |.     :|.|            |.:    |:..|.|..|:|...|:::|:..:||.|||.:.:|
 Worm   385 DN-----RDGPLFNFLGCVRPQVQQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEV 444

Human   195 FT--KRKGHILELLTEVTRRMAEAELVQEG-KARKTNPEIQSTLRKRLY 240
            |:  .:...::||||||.:::|......:| ...|..||:.|.|.|:.|
 Worm   445 FSTHAKDMDVVELLTEVNKKVACGFQTSQGSNILKQMPEMTSRLLKKFY 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CASP14NP_036246.1 CASc 18..242 CDD:237997 69/244 (28%)
ced-3NP_001255708.1 CARD 2..90 CDD:128424
CASc 235..496 CDD:214521 69/244 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.