DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN15 and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_036471.1 Gene:TSPAN15 / 23555 HGNCID:23298 Length:294 Species:Homo sapiens
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:265 Identity:59/265 - (22%)
Similarity:98/265 - (36%) Gaps:92/265 - (34%)


- Green bases have known domain annotations that are detailed below.


Human     9 VRYCARFSYLWLKFSLIIYSTVFWLIGALVLSVGIYAEVERQKYK------TLESAFLAPAIILI 67
            ||.|       |:::.:::||:..::|.|....|:|   |..|:.      |.:...|..|..||
  Fly     4 VRVC-------LQWTSVVFSTLTLIVGVLAALAGVY---ELDKFNEGSAEHTEKFVQLGMAGALI 58

Human    68 LLGVVMFMVSFIGVLASLRDNLYLLQAFMYILGICLIMELIGGVVALTFRNQT--IDFLNDNIRR 130
            |.|:|..:.:..|.:..:..||.||.|.           :...:..::..|:|  :|        
  Fly    59 LAGLVGCLGAIFGSIKVMVVNLILLLAL-----------IASHIWKVSHYNETKQLD-------- 104

Human   131 GIENYYDDLDFKNI-----MDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNT 190
            ..|.|..||..|.:     |..:|::::|||.:.:.|::.           |...||.:|     
  Fly   105 ATEVYVMDLWMKELVHHGAMQDLQQEYECCGDKGFSDYTS-----------LNMKVPRSC----- 153

Human   191 TEVVNTMCGYKTIDKERFSVQDVI-----YVRGCTNAVIIWFMDNYTI------------MAGIL 238
                             |..:|.|     |..||..||...::..|..            :.||:
  Fly   154 -----------------FHTKDGIHALYPYGEGCMAAVKRAYLQIYRYEKWVHCGLIGYEVVGII 201

Human   239 LGILL 243
            |||.|
  Fly   202 LGITL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN15NP_036471.1 penumbra_like_LEL 114..231 CDD:239411 26/128 (20%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 57/262 (22%)
tetraspanin_LEL 110..178 CDD:239401 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.