DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK20 and Cdk7

DIOPT Version :9

Sequence 1:XP_016870050.1 Gene:CDK20 / 23552 HGNCID:21420 Length:351 Species:Homo sapiens
Sequence 2:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster


Alignment Length:323 Identity:130/323 - (40%)
Similarity:188/323 - (58%) Gaps:14/323 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     2 DQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLE---DGFPNQALREIKALQEMEDNQY 63
            ::|..|..:|||....|:||:...|.:|||:||:.....|   ||....||||||.|||:: ::.
  Fly    10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQ-HEN 73

Human    64 VVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDL 128
            ::.|..||.......|.|:||.:||..:::..:..|.||.:|:|..|.|||:.:.|.|.|:||||
  Fly    74 IIGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWILHRDL 138

Human   129 KPANLLISASGQLKIADFGLARVF-SPDGSRLYTHQVATSPLPRRWYRAPELLYGARQYDQGVDL 192
            ||.|||:::.|.|||.|||||:.| ||  :|:|||.|.|     ||||:||||:|||||..|||:
  Fly   139 KPNNLLVNSDGILKIGDFGLAKSFGSP--NRIYTHHVVT-----RWYRSPELLFGARQYGTGVDM 196

Human   193 WSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEE 257
            |:||||:.||:...|..||.:|::||..:...||||....||.|::|.||  :.|:.....||:.
  Fly   197 WAVGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDY--LQFRNFPGTPLDN 259

Human   258 VLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHP 320
            :........:.|:.:.....|.:|::..:||...||...|.|....:||:|..:......|:|
  Fly   260 IFTAAGNDLIHLMQRLFAMNPLRRVSCREALSMPYFANKPAPTVGPKLPMPSAILAAKEGANP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK20XP_016870050.1 None
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 125/307 (41%)
STKc_CDK7 11..308 CDD:270833 125/306 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0659
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1367115at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.