DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FOSL2 and CrebB

DIOPT Version :9

Sequence 1:XP_006712039.1 Gene:FOSL2 / 2355 HGNCID:3798 Length:343 Species:Homo sapiens
Sequence 2:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster


Alignment Length:282 Identity:54/282 - (19%)
Similarity:90/282 - (31%) Gaps:122/282 - (43%)


- Green bases have known domain annotations that are detailed below.


Human    16 SSGSPAHAESYSSGGG--------------------GQQKFRVD--MPGSGSAFIPT-------- 50
            ::|.|..|.:.:.|||                    .|...:|.  :..:.|..|.|        
  Fly    59 TAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLAQHGLQVQSVIQANPSGVIQTAAGTQQQQ 123

Human    51 --INAITTSQDLQWMVQP---TVI-------TSMSNPYPRSHP--YSPLPG-------------- 87
              :.|.|..|.:.::.:|   |||       ..:.|..|.:.|  ..|.|.              
  Fly   124 QALAAATAMQKVVYVAKPPNSTVIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDD 188

Human    88 --------LASVPGH--------------MALP-RPGVIKT--IGTTVGRRRRDE---QLSP--- 121
                    |...|.:              .:|| ..||:.:  .||..|....:.   ||.|   
  Fly   189 DSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYY 253

Human   122 ----------------EEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAIGPWQVAVPHIPLFPW 170
                            ::..||.||.::|:.||.:||.:::|..:.|:.    :|||        
  Fly   254 LSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLEN----RVAV-------- 306

Human   171 QETEELEEEKSGLQKEIAELQK 192
                 ||.:...|.:|:..|::
  Fly   307 -----LENQNKALIEELKSLKE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FOSL2XP_006712039.1 bZIP_Fos 134..204 CDD:269869 15/59 (25%)
coiled coil 134..195 CDD:269869 15/59 (25%)
CrebBNP_001334685.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.