DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and CG10300

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster


Alignment Length:289 Identity:51/289 - (17%)
Similarity:99/289 - (34%) Gaps:83/289 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSGRVGDLSPRQKEALAKFRENVQDV---------------LPALPNP-DDYFLLRWLRARSFDL 49
            |:..:..|.|: ..||||...|.:..               .|.|..| |:..:|.:||...|..
  Fly     1 MANTLRTLDPK-LAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQ 64

Human    50 QKSEAMLRKHVEFRK-------QKDID-----------NIISWQP--PE----VIQQYLSGGMCG 90
            ::::.....:...|.       .:.:|           ::|..:|  ||    :|.|:.:     
  Fly    65 EETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRN----- 124

Human    91 YDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDC 155
                           :|.|    .::.::..:......|||..||.:..      :..:..:.|.
  Fly   125 ---------------IDPK----KSNPREAFKLIFIMLELLALECDNAA------ISGLIWVVDA 164

Human   156 EGLGLKHLWKPAVEAYGEFL-----CMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRK 215
            ..:.::.:.:     |..||     .:.::..|.....:.::...|.....:|.:..||......
  Fly   165 RDVTMEQMMQ-----YDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPF 224

Human   216 KIMVLGANWKEVLLKHISPDQVPVEYGGT 244
            |.:|  ....|.|.:|:..|.:.:|||||
  Fly   225 KFVV--HKKSEDLYQHLPRDVMTIEYGGT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 13/61 (21%)
SEC14 76..244 CDD:214706 30/178 (17%)
CG10300NP_651174.2 SEC14 95..251 CDD:238099 31/192 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.