DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and pinta

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster


Alignment Length:263 Identity:60/263 - (22%)
Similarity:106/263 - (40%) Gaps:68/263 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    41 WLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISW------QPPEVIQQYLSGGMCGYDLDGCPVW 99
            :||...||:::::..|:...:.|.::     ..|      |.|| ||..|..|:           
  Fly    51 FLRTSKFDVERAKKKLKTFYQMRAER-----TEWFDNRDPQLPE-IQDLLKLGV----------- 98

Human   100 YDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTK------LGRKVET----ITIIYD 154
            :..||| ||:..:..     ::||...:.:|..|....:|:|      |....||    :..|.|
  Fly    99 FLPIGP-DAEQRMVV-----VIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDPETCARGMVAILD 157

Human   155 CEGLGLKH-------LWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSED 212
            .:|:.|.|       |.|.:||::..:.|.     |:.|:   ...||:......|..:.|::..
  Fly   158 MQGVQLGHALQMNPKLIKRSVESWTAYPCQ-----PKLLE---FTNAPRHVNFFLNTFRIFMTPK 214

Human   213 TRKKIMVL--GANWKEVLLKHISPDQVPVEYGGT-MTDPDGNPKCKSKINYGGDIPRKYYVRDQV 274
            .|.::.|.  |.:        :|.||:|.|.||. ::..:.:.|.|..:....|.   |..:|:.
  Fly   215 IRSRLFVRREGTS--------VSCDQLPKELGGQGLSYMELSVKWKQLVEENADF---YVEQDKY 268

Human   275 KQQ 277
            |.:
  Fly   269 KSK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 5/17 (29%)
SEC14 76..244 CDD:214706 45/186 (24%)
pintaNP_001287466.1 SEC14 87..240 CDD:238099 45/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.