DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and CG33965

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster


Alignment Length:281 Identity:62/281 - (22%)
Similarity:108/281 - (38%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSG----RVGDLSP-RQKEALAKFRE---NVQDVLPAL-----PNP------DDYFLLRWLRARS 46
            |||    .:..|.| .||.|:.:..|   .|:..:.||     ..|      :|.|||.:||...
  Fly     1 MSGSSPNSIRPLPPGLQKVAIEELNEVPSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSK 65

Human    47 FDLQKSEAMLRKHVE--------FRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLD----GCPVW 99
            |.|:|::..:.:...        |..|:.:||      .:|::....|.:....||    |..|.
  Fly    66 FSLEKAKQKIDRFYSLQAVIPEVFNDQRLVDN------AQVLEIIRLGVILRIPLDEEDTGPAVT 124

Human   100 YDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLW 164
            ....|..|.....|    ||::|......|:::.|..:.:      |.....|.|..|:...:|:
  Fly   125 IIRAGSYDINKFKF----QDIIRVGSMFGEIMMLEDDNAS------VSGYLEIMDMSGVTGANLF 179

Human   165 KPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLL 229
            ....:...:|....:|..|...|.:..:..||.|...:..:..:.....::::.|  ::..|.:.
  Fly   180 ALQPQLLSKFSAYADEAMPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSV--SSDPEAIF 242

Human   230 KHISPDQVPVEYG---GTMTD 247
            :.:....:|.|||   |||.|
  Fly   243 ERVPKHYLPEEYGGSKGTMKD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 16/59 (27%)
SEC14 76..244 CDD:214706 32/174 (18%)
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 12/44 (27%)
SEC14 101..256 CDD:238099 30/166 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.