DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and CG33523

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:412 Identity:80/412 - (19%)
Similarity:150/412 - (36%) Gaps:102/412 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSGRVGDLSPRQKEALA-KFRENVQDVLPALP-NP--------DDYFLLRWLRARSFDLQKSEAM 55
            |..:|.:.:|:|.|.|. :|........||.| :|        |..:|.|:|.....|::.|...
  Fly     1 MGVKVKETTPQQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNS 65

Human    56 LRKHVEFRKQ---KDIDNIISWQPPEVIQQYLSGG---MCGYDLDGCPVWYDIIGPLDAKGLLFS 114
            |.:....|:.   .|||.      .|:.|:||..|   :...|:||.|:            |:|.
  Fly    66 LWETCILRQSTGANDIDE------SELNQEYLKEGSVFVHNTDVDGKPL------------LVFR 112

Human   115 ASKQDLLRTKMRECELLLQECAH--QTTKLGRKVETITIIYDCEGLGLKHL----WKPAVEAYGE 173
            ..    :.:|.:..:.|::...:  :.|:..:.:..:||.:|..|..|..:    .|..||.:.:
  Fly   113 VK----MHSKSKNLDELIRIVVYWVERTQREQHLTQLTIFFDMSGTSLASMDLEFVKRIVETFKQ 173

Human   174 FLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVP 238
            |       ||.:|..:.|.:...:...|:.:||..|..   |.:.:|....|:.:.::|:.|...
  Fly   174 F-------YPNSLNYILVYELGWVLNAAFKVIKAVLPP---KAVEILKMISKKDINQYINKDNCL 228

Human   239 VEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQ-VEYEILFPGCV 302
            ..:||             :.||      ::....:.|:.....|..:.|...| .:.::.|    
  Fly   229 AIWGG-------------EDNY------EFSFVPEAKKVISKPVAANAGDDDQFADKKVTF---- 270

Human   303 LRWQFMSDGADVGFGIFLKTKMGERQRAGE-MTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFD 366
                  .|.|.:   :..:|.:.:.....| |..:.|....|.:....:.|:|...         
  Fly   271 ------VDSAPM---VLKETNINKMHTPSEGMLHINPKDFVNFNSKNAEATMTIKS--------- 317

Human   367 NTYSFIHAKKVNFTVEVLLPDK 388
                 |....|.:.::...|:|
  Fly   318 -----IATSAVTYKIQTTSPEK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 14/55 (25%)
SEC14 76..244 CDD:214706 37/176 (21%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 34/178 (19%)
Motile_Sperm 293..396 CDD:279029 9/56 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.