DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and Cralbp

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:262 Identity:55/262 - (20%)
Similarity:108/262 - (41%) Gaps:68/262 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    12 QKEALAKFR------ENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQ-KDID 69
            ::::|.:.|      |::|:|     ..||.||||:|||:.|.:..:|..|.|::..|:. ..:.
  Fly    30 REQSLEQLRNWVAKNEDLQNV-----RCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMS 89

Human    70 NIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDL------------LR 122
            ..:.:..|.                        :|.|..:|.:|:..::|.            |.
  Fly    90 TQLDYLEPR------------------------LGDLIDQGYIFAVPQRDKHGRRVVVINAKGLN 130

Human   123 TKMR-ECE-----LLLQECAHQTTKLGRKVETITIIYDCEGLGLKHL--WKPAVEAYGEFLCMF- 178
            .|:. .|:     .|..||..:..:  .::..:|.:.|..|:...|:  |.|.     ||..:| 
  Fly   131 PKIHTSCDQAKAHFLTYECLMEDQE--TQITGLTHVGDFAGVTTAHVTNWNPT-----EFARIFK 188

Human   179 --EENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEY 241
              |::.|...|.:.::..|.......:.:|..:|...:.::::.|:. || |:|.:....:|:|.
  Fly   189 WGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSE-KE-LMKSVDQGCLPLEM 251

Human   242 GG 243
            ||
  Fly   252 GG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 17/51 (33%)
SEC14 76..244 CDD:214706 36/191 (19%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 17/51 (33%)
SEC14 101..254 CDD:238099 34/162 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.