DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and CG32485

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster


Alignment Length:236 Identity:47/236 - (19%)
Similarity:106/236 - (44%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     7 DLSPRQKEALAKFRENVQDVLPALPNP--DDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDID 69
            :|:|..::.....:|.::.::.|.|..  :|:.|.|:|||........:|:|:.: ::|:...:|
  Fly     5 ELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAILKTN-KWRETYGVD 68

Human    70 NIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQE 134
            .:......::.::  :..:...|..|.||.|     :.||.........:|.|..:...|...::
  Fly    69 KLSEMDRSQLDKK--ARLLRHRDCIGRPVIY-----IPAKNHSSERDIDELTRFIVYNLEEACKK 126

Human   135 CAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFP 199
            |..:.|      :.:.|::|........:....|:   ..:.:..:::||.|....::.:|.||.
  Fly   127 CFEEVT------DRLCIVFDLAEFSTSCMDYQLVQ---NLIWLLGKHFPERLGVCLIINSPGLFS 182

Human   200 VAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVE 240
            ..:..|:..|.::|.||:..: |:..| |.:::.||.:|.:
  Fly   183 TIWPAIRVLLDDNTAKKVKFV-ADEAE-LCQYLIPDILPTD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 11/47 (23%)
SEC14 76..244 CDD:214706 32/165 (19%)
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 31/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.