DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and CG10026

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:276 Identity:59/276 - (21%)
Similarity:108/276 - (39%) Gaps:77/276 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     6 GDLSPRQKEALAKFRENVQDVLPALPNPDD-YFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDID 69
            |:....:.:.:.:||..:.:.....|:..| .:|.::||||.:.::.|..:|..:..||:|.   
  Fly    36 GECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQN--- 97

Human    70 NIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLR-TKMRE------ 127
                                       ..:|:.:.|||    |....:.|:|. |..|:      
  Fly    98 ---------------------------KSFYEKVRPLD----LRHVGQSDILTVTPYRDQHGHRI 131

Human   128 --------------------CELLLQECAHQTTKLGRKVETITI------IYDCEGLGLKHLWKP 166
                                ..::|||       || .:|.|:.      |:|.:.|||:|:...
  Fly   132 LIYRFGLWRPNQVTVDDIFRATIVLQE-------LG-SLEPISQIVGGVGIFDLKDLGLEHILHL 188

Human   167 AVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKH 231
            :.....:.:.:...:.|.....|.:|....:|..|:.:.||||:...|:|:.:.|::... |.||
  Fly   189 SPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTS-LHKH 252

Human   232 ISPDQVPVEYGGTMTD 247
            |:|:.:|..|||...|
  Fly   253 INPEHLPKRYGGLHED 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 11/46 (24%)
SEC14 76..244 CDD:214706 42/200 (21%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/46 (24%)
SEC14 112..265 CDD:238099 37/161 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.