DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and CG5958

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster


Alignment Length:290 Identity:71/290 - (24%)
Similarity:119/290 - (41%) Gaps:65/290 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     4 RVGDLSPR---------------QKEALAKFRENVQDVLPALP----NPDDYFLLRWLRARSFDL 49
            |:|.|.|.               :.||:.|.||    :|.|.|    ..||.||..:|||..|..
  Fly    14 RLGYLKPETVEIARVELRETEEVKAEAIIKLRE----LLKATPELNYKDDDAFLTVFLRACHFYP 74

Human    50 QKSEAMLRKHVEFRKQ--KDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKG-- 110
            :.:...::....|||:  ..:..::..|   |.::::.|.:... |..|          |.||  
  Fly    75 EGALEKMKTTASFRKEYASLVRGLLVEQ---VKEKFVKGSVINV-LKNC----------DQKGRR 125

Human   111 -LLFSASK----QDLLRTKMRECELLLQECAHQTTKLGR--KVETITIIYDCEGLGLKHLWKPAV 168
             |:.:..|    .|:...:|    ..:....|...:|..  :|..:..|.|.|||.:|.: |...
  Fly   126 VLIVNCGKLWDPSDITSDEM----FRMLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQV-KALS 185

Human   169 EAYGEFLCMF-EENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHI 232
            .::.:.|..| :|..|..:|.:..||.|.:|.:.::|.|||:.:....::...|::.|. |.|.:
  Fly   186 PSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKS-LQKFL 249

Human   233 SPDQVPVEYGGTMTDPDGNPKCKSKINYGG 262
            .|..:|..|.||:          ..|:|||
  Fly   250 DPSVLPANYKGTL----------PAIDYGG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 16/49 (33%)
SEC14 76..244 CDD:214706 41/177 (23%)
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 16/47 (34%)
CRAL_TRIO 111..261 CDD:279044 39/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.