DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and CG33514

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster


Alignment Length:272 Identity:63/272 - (23%)
Similarity:109/272 - (40%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSGRVGDLSPR----QKEALAKFRENVQDVLPAL-----------PNPDDYFLLRWLRARSFDLQ 50
            ||.::..|:|.    .||.|.:..|.::..|.|.           |..||.||:.:||...:.|:
  Fly     1 MSPQIRPLTPELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLE 65

Human    51 KSEAMLRKHVEFR-KQKD---IDNIISWQPPEVIQQ----YL------SGGMCGYDLDGCPVWYD 101
            ::::.|.|:...: |..|   :.|....:..|:.|.    ||      :|...|       :|..
  Fly    66 RAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIG-------IWRM 123

Human   102 IIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKP 166
            .:.|::...:|....    :...|:|..:|..:.|:        |..:..|.|.:|....||::.
  Fly   124 GLVPVEKYTMLECMQ----VAQAMQEIAILEDDYAN--------VNGVVFIMDMKGATAAHLFQM 176

Human   167 AVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKH 231
            ......:|....||..|..||....:.....|...:|:.||.:|:..:.::.|.| |...:|.:.
  Fly   177 TPSMAKKFTVFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHG-NKMGLLTEQ 240

Human   232 ISPDQVPVEYGG 243
            |....:|.||||
  Fly   241 IPLKYLPEEYGG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 15/56 (27%)
SEC14 76..244 CDD:214706 40/178 (22%)
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 11/45 (24%)
SEC14 97..253 CDD:238099 40/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.