DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and CG31826

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:262 Identity:58/262 - (22%)
Similarity:104/262 - (39%) Gaps:39/262 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQ 65
            ::.|| |.:..|...:.:.|:.|:.........:|..|.::|....:|..|:...:..:.||:::
  Fly     4 LTARV-DHTAEQIFKIEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRR 67

Human    66 KDIDNIISW---QPPEVIQQYLSGGMCGY-----DLDG--CPVWYDIIGPLDAKGLLFSASKQDL 120
            ..     :|   .|.|..:|...|..|.|     |..|  ..|:..:.|..|....|.|..:.|.
  Fly    68 HP-----TWVARHPIEHYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQSLVEMDD 127

Human   121 LRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHL--WKPAVEAYGEFLCMFEEN-- 181
            |   :.|..|||...         :...||:|.|.:|.....|  :.||      |:.:..|.  
  Fly   128 L---IFESLLLLPRV---------QQNGITVICDLQGTNRNFLRQFSPA------FMKVVNEKNG 174

Human   182 -YPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTM 245
             .|.:.:.:.:::...|..|...|..||::::.::||..........|.:.:..:.:|.||||..
  Fly   175 VLPFSQRIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPA 239

Human   246 TD 247
            |:
  Fly   240 TN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 7/45 (16%)
SEC14 76..244 CDD:214706 42/179 (23%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 7/43 (16%)
CRAL_TRIO 92..237 CDD:279044 35/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.