DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and CG3091

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster


Alignment Length:260 Identity:55/260 - (21%)
Similarity:102/260 - (39%) Gaps:46/260 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     9 SPRQKEALAKFRENVQDVLPALPNP-DDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNII 72
            |.:..:.:|.|..|     |.||.. :...:||:|:..:||:::::|:...:...|.:.      
  Fly    23 SDKLTDLVAWFEAN-----PNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKS------ 76

Human    73 SWQPPEVI------QQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQD-LLRTKMRECEL 130
                |.:.      .:..:.|:...||...|.    :.|...|.:.|..:..| ..|..:.|.::
  Fly    77 ----PHLFMDRNMEDEMTAEGLRVSDLLILPG----VTPQGNKLIFFRMADLDPRTRNSVEETKI 133

Human   131 LLQECAHQTTKLGRKVET-----------------ITIIYDCEGLGLKHLWKPAVEAYGEFLCMF 178
            .:.....:.||...:.||                 :.|: |..|..|:||...::.....::...
  Fly   134 FVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQIV-DIGGYTLRHLAYVSIFVLRVYMKFL 197

Human   179 EENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGG 243
            :|.||..|:.:.|:..|.......:::.|||.|:.|..|. ......:.|.|.:..|.:|.||||
  Fly   198 QEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIR-YHTEGMDSLYKEVPRDMLPNEYGG 261

Human   244  243
              Fly   262  261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 12/46 (26%)
SEC14 76..244 CDD:214706 41/192 (21%)
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 37/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.