DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC14L2 and CG30339

DIOPT Version :9

Sequence 1:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:297 Identity:67/297 - (22%)
Similarity:114/297 - (38%) Gaps:54/297 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    23 VQDVLPALPN----PDDYFLLRWLRARSFDLQKSEAMLRKHVEF---------RKQKDIDNIISW 74
            ::|.|...|:    .||.||:.:||...|.|:|:::.|......         ::..|..|:|..
  Fly    33 LRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKLDHFYTIKTLMPELFGKRLVDERNLILC 97

Human    75 QPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQT 139
            :....::.....|..|..|.  ...|:...|.:.|.|       ||.|.:....|..::|..|  
  Fly    98 RSGTYVRLPKPWGTDGPRLQ--LTNYEKFDPKEFKLL-------DLFRYQTMITEQSIREDDH-- 151

Human   140 TKLGRKVETITIIYDCEGLGLKHLWK---PAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVA 201
            :.:...||    |.|...:.|..|.:   ..::..|.|.   |:..|..||.:.::..||.....
  Fly   152 SNISGYVE----IVDMAKMSLSFLAQLDFTLIKRMGIFA---EKAQPTRLKGVHLINCPKEGVAL 209

Human   202 YNLIKPFLSEDTRKKIMVLGANWK--EVLLKHISPDQVPVEYGGT---MTDPDGNPKCKSKINYG 261
            .||.|..:....:::..|    :|  |.|.:.|..:.:|.||||.   :.|.....: |..::| 
  Fly   210 LNLAKSLMPSKLQQRFHV----YKNLEQLNEVIPREYLPEEYGGNNGRIADIQAEAE-KKLLSY- 268

Human   262 GDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILF 298
                ..|:..|   .||....|:..|.  :|..:.:|
  Fly   269 ----ESYFAED---SQYGVDEQLRPGK--RVNADSIF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 13/39 (33%)
SEC14 76..244 CDD:214706 39/172 (23%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 12/36 (33%)
CRAL_TRIO 109..250 CDD:279044 39/162 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.