DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FOSB and kay

DIOPT Version :9

Sequence 1:NP_006723.2 Gene:FOSB / 2354 HGNCID:3797 Length:338 Species:Homo sapiens
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:223 Identity:73/223 - (32%)
Similarity:98/223 - (43%) Gaps:58/223 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    44 CAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQ------GQPLASQPPVVDPYD---- 98
            |||..      ||.|  :..:.|:..:..||.:||:...|      ||...|:.......|    
  Fly   279 CAGFA------VPKV--LPNAIDVLGMGIPTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMN 335

Human    99 ------------MPGTSYST----------PGMSGYSS---------GGAS-GSGGPSTSGTTSG 131
                        ...|||..          .|::.:|:         |.|| ||...:||.|   
  Fly   336 EEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRGSASVGSSNANTSNT--- 397

Human   132 PGPARPARARPRRPREET-LTPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKA 195
              |||  |...|||...| :|||||:||.|||||||.|||:||.||.:.|:.|..|.:|||:...
  Fly   398 --PAR--RGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGE 458

Human   196 ELESEIAELQKEKERLEFVLVAHKPGCK 223
            .:..||..|...|.:||::|..|:..|:
  Fly   459 SMRKEIEVLTNSKNQLEYLLATHRATCQ 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FOSBNP_006723.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..191 51/154 (33%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 157..182 17/24 (71%)
bZIP_Fos 165..218 CDD:269869 22/52 (42%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 183..211 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..276 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..338
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/60 (48%)
coiled coil 421..480 CDD:269869 28/58 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42280
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.