DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KAT6B and CG1894

DIOPT Version :9

Sequence 1:NP_001357065.1 Gene:KAT6B / 23522 HGNCID:17582 Length:2073 Species:Homo sapiens
Sequence 2:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster


Alignment Length:414 Identity:134/414 - (32%)
Similarity:210/414 - (50%) Gaps:66/414 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   556 QSRKKGHPSYAP-----------PKRMRRKTELSSTAKSKAHFFGKRDIRSRFISHSSS-SSWGM 608
            ::|...|..|.|           |. :.|..:|::..:|.|         :|.:..|:| |..|.
  Fly     4 ENRSGDHLKYQPLGDQDGISSKLPD-IPRALQLTNAKESSA---------TRGLGQSASKSEMGK 58

Human   609 AR----GSIFKAIAHFKRTT--FLKKHRMLGRLKYKVTPQM---GTPSPGKGSLTDGRIKPDQDD 664
            ::    .|:.|.|...|..|  .::..|:      ..||:.   |...|...||.......:.||
  Fly    59 SQLQNDSSLQKNIQETKTITGSCIEAQRI------GATPKKQLEGVKEPNMISLLHTNASSNVDD 117

Human   665 DTEIKINIKQESADVNVIGNKDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRYPSVIEFGKYE 729
                  ..:||:.|           .|..||.|:.::   .|::....:|.       ::||:||
  Fly   118 ------RQRQETID-----------NEKSDVQKEKED---AKVKVIRNIEK-------VQFGRYE 155

Human   730 IQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEVDG 794
            |:|..|||||....:...:|:||||||||..:.....|...|....||.:.:||:.::.::||||
  Fly   156 IETTSSSPYPVINDKATTIYVCEFCLKYMCLRKSYSYHLYDCKKRCPPGSLLYRKDNIYIYEVDG 220

Human   795 NMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYFSKEKLCQQKYNVSCIM 859
            :..::|||.|||::||||::|.:.|....||||:|...|:.|.|..|||::|| .....|::||:
  Fly   221 HKEQLYCQCLCLMSKLFLENKKILYSSSSFLFYILCLKDKDGEHFAGYFAREK-TMLNINLNCIL 284

Human   860 IMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYLAYWKSVILEYLYHHHERH-IS 923
            ::|.:.|:|:|:.|||.||.:||||...|.|:||||.:.||.||:||..::|..|.||.... ::
  Fly   285 VLPPYMRKGYGKLLIDLSYEISRREACIGGPKKPLSKVARLCYLSYWGHILLNLLRHHSSPDLVT 349

Human   924 IKAISRATGMCPHDIATTLQHLHM 947
            |:.:|:|||....||.:||:.:.|
  Fly   350 IEELSKATGFREEDIISTLEFMGM 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KAT6BNP_001357065.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..97
H15 113..167 CDD:197772
PHD1_MOZ_MORF 212..269 CDD:277090
PHD2_KAT6A_6B 271..317 CDD:277002
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..409
Negatively regulates HAT activity 361..717 37/181 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..583 7/37 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..663 6/26 (23%)
Catalytic 718..1008 97/231 (42%)
PLN00104 <721..989 CDD:215056 97/228 (43%)
Interaction with BRPF1. /evidence=ECO:0000269|PubMed:18794358 752..1008 84/197 (43%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q92794 856..860 2/3 (67%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q92794 865..871 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1022..1452
BASP1 1435..>1564 CDD:310221
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1484..1538
Interaction with RUNX1 and RUNX2. /evidence=ECO:0000269|PubMed:11965546 1560..2073
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1580..1619
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 102/255 (40%)
MOZ_SAS 202..378 CDD:280097 75/173 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.