DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCRIB and Lap1

DIOPT Version :9

Sequence 1:NP_874365.3 Gene:SCRIB / 23513 HGNCID:30377 Length:1655 Species:Homo sapiens
Sequence 2:NP_001188938.1 Gene:Lap1 / 36670 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster


Alignment Length:911 Identity:260/911 - (28%)
Similarity:408/911 - (44%) Gaps:166/911 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     3 KCIPLWRCNRH--VESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLNLRKLG 65
            ||.|.::..|.  ::.:|..:..|...| |::::.|:||||.|...:|:.||...|....||.|.
  Fly     6 KCFPCFKFKREEVIDKLDYSNTPLTDFP-EVWQHERTLEELYLSTTRLQALPPQLFYCQGLRVLH 69

Human    66 LSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPDGFTQLRSL 130
            ::.|.::.:|..:.:..||..||::||.|..:||.||.||.|...|.|.|.|.||||..|.|.||
  Fly    70 VNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISL 134

Human   131 AHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTLGA 195
            ..|.||:..|:.||.:.|.|.||..||||.|.|.:||.|:..|:.|::||:|||:...||:.:|.
  Fly   135 QELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGE 199

Human   196 LPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELGGLVLLTDLLLSQNLLRRLPD 260
            |.:|||||:|.||:..:...:|.||.|...:.:.|.|:.||:||.....:..|.:..|.|...|.
  Fly   200 LKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPF 264

Human   261 GIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENLLMALPRSLGKLTKLTNLNVDRNHLE 325
            .:|.||.|...|.:.|.|.|:.::|...|.|.||:|:.|.|:.||.::|.|..|..|..|.|.|.
  Fly   265 SVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLR 329

Human   326 ALPPEIGGCVALSVLSLRDNRLAVLPPELAHTTELHVLDVAGNRLQSLPFALTHL-NLKALWLAE 389
            .||.|:..|..|||||:.:|:|:.||..:.:.:::.||:|..|.:.:||.::.:| ||.::||::
  Fly   330 QLPDELCSCQQLSVLSVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSMWLSD 394

Human   390 NQAQPMLRFQTEDDARTGEKVLTCYLLP--------------------------QQPPPS----L 424
            ||:||::..|..|.:...:  |||::||                          |||..|    :
  Fly   395 NQSQPLVPLQYLDASTKTQ--LTCFMLPQVTFKMNSIQAQQQAQEQYEFVYANQQQPHASPSRRI 457

Human   425 EDAGQQGSLSETWSDAPPSRVSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIE 489
            ..|.:...||...:...|:..|.:.....|..|:.|....     |.|..||:|.||:.|.:.: 
  Fly   458 CFAEEATILSNAKAQPAPNYPSFVAAPPTPTPDQMAGSVR-----LMRSPTPYPKELRQMSKYV- 516

Human   490 GRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDS---------RPSASTVSEAEPEGPSAEAQG 545
             |:::|.    .|.:......|.|:.....:..||         :.:.|.:....||  :....|
  Fly   517 -RQAQAA----TSSANASEVREARVVTNGQIHCDSNNANQDVVDQATTSAIYGIAPE--TTHIYG 574

Human   546 ---GSQQEATTAGGEE-------DAEEDYQE---------PTVHFAEDALLPGD-DREIE--EGQ 588
               ..||.|.....:|       :.|..||:         ||.|      |.|| |.|::  :.|
  Fly   575 VYQQPQQMAHPVPTQEYYGLPLVNYEAHYQQLYVEANTPLPTTH------LNGDQDYELQPLQQQ 633

Human   589 PEAPWTLPGGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGMQPDGEGPVAPGGWHNGPHAPW 653
            |.....||..|    .:..|::.......|.|:.   :.|.:.|                     
  Fly   634 PMQQQALPTPR----LEPPPYHIARVYTKKTPED---LNLYESM--------------------- 670

Human   654 APRAQKEEEEEEEGSPQEEEEEEEEENR-----AEEEEASTEEEDKEGAVVSAPSVKGVSFDQAN 713
              |.:|::::.:|.:..::........:     |::.|.|.::.|.:..:             :|
  Fly   671 --RQRKQQQQLQEQTIYQDALNSNSNFKTTAIGAQDVEESVDQLDYQNNI-------------SN 720

Human   714 NLLIEPARIEEEELTLTI----LRQTGGLGISIAGGKGSTPYKG--------------------- 753
            ||...|.. |::||..|:    |..|.....|.|..|.||...|                     
  Fly   721 NLEPNPEE-EDQELDDTMSQHSLNSTATNNTSKASHKKSTWIFGVHKNPTVKQVTLKWENSIGFD 784

Human   754 -----DDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWR 813
                 :..|||:|.::....|||. :.:.|||||::|..|..|...:|...|...||.:.:.:.|
  Fly   785 IAELLNQVGIFVSSITPNTNAARL-LNLNDKLLEIDGYDLTNANLSDAKRVLLNCGTVMNIMLSR 848

Human   814 E 814
            :
  Fly   849 K 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCRIBNP_874365.3 Sufficient for targeting to adherens junction and to inhibit cell proliferation 1..818 260/911 (29%)
LRR_RI 12..232 CDD:238064 89/221 (40%)
leucine-rich repeat 14..37 CDD:275380 4/22 (18%)
leucine-rich repeat 38..60 CDD:275380 9/21 (43%)
LRR 39..401 CDD:227223 145/362 (40%)
leucine-rich repeat 61..83 CDD:275380 5/21 (24%)
leucine-rich repeat 84..106 CDD:275380 11/21 (52%)
leucine-rich repeat 107..129 CDD:275380 11/21 (52%)
leucine-rich repeat 130..152 CDD:275380 9/21 (43%)
leucine-rich repeat 153..175 CDD:275380 11/21 (52%)
leucine-rich repeat 176..198 CDD:275380 10/21 (48%)
leucine-rich repeat 199..221 CDD:275380 10/21 (48%)
leucine-rich repeat 268..290 CDD:275380 6/21 (29%)
leucine-rich repeat 291..313 CDD:275380 10/21 (48%)
leucine-rich repeat 314..336 CDD:275380 9/21 (43%)
leucine-rich repeat 360..381 CDD:275380 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 417..440 8/52 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..604 40/175 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 633..702 7/73 (10%)
Interaction with ARHGEF7. /evidence=ECO:0000269|PubMed:15182672 717..1229 33/128 (26%)
PDZ 725..813 CDD:214570 30/117 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 827..853
PDZ_signaling 860..947 CDD:238492
PDZ_signaling 1002..1090 CDD:238492
PDZ_signaling 1098..1189 CDD:238492
Interaction with tick-borne encephalitis virus RNA-directed RNA polymerase NS5. /evidence=ECO:0000269|PubMed:18042258 1105..1117
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1227..1246
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1277..1489
AbLIM_anchor 1555..>1593 CDD:292800
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 74/179 (41%)
leucine-rich repeat 21..41 CDD:275380 4/20 (20%)
LRR_8 40..98 CDD:290566 21/57 (37%)
leucine-rich repeat 42..64 CDD:275380 9/21 (43%)
leucine-rich repeat 65..87 CDD:275380 5/21 (24%)
LRR_8 86..140 CDD:290566 27/53 (51%)
leucine-rich repeat 88..110 CDD:275380 11/21 (52%)
leucine-rich repeat 111..133 CDD:275380 11/21 (52%)
leucine-rich repeat 134..156 CDD:275380 9/21 (43%)
LRR_8 156..213 CDD:290566 29/56 (52%)
leucine-rich repeat 157..179 CDD:275380 11/21 (52%)
leucine-rich repeat 180..202 CDD:275380 10/21 (48%)
leucine-rich repeat 203..225 CDD:275380 10/21 (48%)
leucine-rich repeat 226..248 CDD:275380 7/21 (33%)
leucine-rich repeat 272..294 CDD:275380 6/21 (29%)
LRR_8 279..328 CDD:290566 19/48 (40%)
leucine-rich repeat 295..317 CDD:275380 10/21 (48%)
leucine-rich repeat 318..340 CDD:275380 9/21 (43%)
LRR_8 340..396 CDD:290566 20/55 (36%)
leucine-rich repeat 364..386 CDD:275380 7/21 (33%)
PDZ_signaling 770..846 CDD:238492 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA7S
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D148064at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.