DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCTD2 and CG14647

DIOPT Version :10

Sequence 1:NP_056168.1 Gene:KCTD2 / 23510 HGNCID:21294 Length:263 Species:Homo sapiens
Sequence 2:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster


Alignment Length:128 Identity:60/128 - (46%)
Similarity:75/128 - (58%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    57 PGPGPPERAGGGGAARWVRLNVGGTYFVTTRQTL-GREPKSFLCRLCCQEDPELDSDKDETGAYL 120
            |..|....|.|....|||:|||||..:.||..|| ||||.|.|.|:..|......|::||.||||
  Fly    19 PAAGDFVAASGFAPNRWVKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMKPSERDEQGAYL 83

Human   121 IDRDPTYFGPILNYLRHGKLIITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGPV 183
            |||.|.||.||:||||||:.:....::..||||||.|:.|.|||..::||:...|......|:
  Fly    84 IDRSPRYFEPIINYLRHGQFVCDSNISVLGVLEEARFFGIFSLVTHLEERLGQQETPLGDRPL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCTD2NP_056168.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 4/11 (36%)
BTB_POZ_KCTD2 72..177 CDD:349697 55/105 (52%)
CG14647NP_649465.6 BTB_POZ_KCTD9 34..134 CDD:349677 53/99 (54%)
YjbI 161..322 CDD:440968
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.