DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Igsf9b and DIP-epsilon

DIOPT Version :10

Sequence 1:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:500 Identity:116/500 - (23%)
Similarity:177/500 - (35%) Gaps:106/500 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 SMFKAQDSLSAGKNLVPGGA---HGLREEPEF------VTARAGEGVVLRCDVIHPVTGQPPPYV 61
            |:..:.|:.|.|.....||:   :.:.|:|||      :|..||..|.|.|.|.:  .|.   |.
  Fly    23 SVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKN--LGS---YK 82

Mouse    62 VEWFKFGVPIPIFIKFGYYPPHV---DPEYAGRASLHDKAS---LRLEQVRSEDQGWYECKV--L 118
            |.|..|.....:.:.     .||   :|..:.....|||..   |.:..|:.||:|.|.|::  :
  Fly    83 VAWMHFEQSAILTVH-----NHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTV 142

Mouse   119 MLDQQYDTFHNGSWVHLTINAPPTFTET-PPQYIEAKEGGSITMTCTAFGNPKPIVTWLK-EGTL 181
            ....||      .:|.:.:  ||...:. ....|..:||.::|:.|.|.|:|:|.:.|.: :|..
  Fly   143 TAKTQY------GFVKVVV--PPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNK 199

Mouse   182 LGASAKYQVSD---GSLTVTSVSREDRGAYTCRAYS-IQGEAVHTTHLLVQGPPFIVSPPENITV 242
            :..:...:|.|   .||.:..:||...|||.|.|.: :.........:.|...|.:..|.:.:.:
  Fly   200 IVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGI 264

Mouse   243 NISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDG--------TLIIFRVKPED 299
            .|..:..|.|..||.|.:|.   ||..||.....:........|.|        .|.|..|:..|
  Fly   265 PIGFNITLECFIEANPTSLN---YWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSD 326

Mouse   300 AGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVKWNKD 364
            .|.|.||..|..|....                        .|..|:..|...:||.|..     
  Fly   327 YGNYKCVAKNPRGDMDG------------------------NIKLYMSSPPTTQPPPTTT----- 362

Mouse   365 GRPLQVEKNLGWTLMEDGSIRIEEATEEALGTYTCVPY--NTLGTMGQSAPARLVLKDPPYFTVL 427
                        ||....:    .|.|.||..|...|.  |.:|.:|:.....::.........|
  Fly   363 ------------TLRRTTT----TAAEIALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYL 411

Mouse   428 PGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHNALPS 472
            .......::.::|      .|.......|.| ||.|.|..|.:.|
  Fly   412 SNLNEIDKSKQKL------TGSSPKGFDWSK-GKSSGSHGNLMAS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Igsf9bXP_011240777.1 Ig 43..117 CDD:409353 22/79 (28%)
Ig strand B 43..47 CDD:409353 2/3 (67%)
Ig strand C 61..65 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 1/6 (17%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
I-set 141..227 CDD:400151 23/91 (25%)
Ig strand B 159..163 CDD:409353 1/3 (33%)
Ig strand C 172..176 CDD:409353 0/3 (0%)
Ig strand E 193..197 CDD:409353 2/3 (67%)
Ig strand F 207..212 CDD:409353 3/4 (75%)
Ig strand G 220..223 CDD:409353 0/2 (0%)
Ig_3 230..309 CDD:464046 23/86 (27%)
Ig 338..412 CDD:472250 17/75 (23%)
Ig strand B 344..348 CDD:409353 1/3 (33%)
Ig strand C 357..362 CDD:409353 1/4 (25%)
Ig strand E 382..386 CDD:409353 0/3 (0%)
Ig strand F 396..401 CDD:409353 1/4 (25%)
Ig strand G 409..412 CDD:409353 1/2 (50%)
Ig 431..507 CDD:472250 9/41 (22%)
Ig strand B 440..444 CDD:409353 1/3 (33%)
Ig strand C 453..457 CDD:409353 0/3 (0%)
Ig strand E 473..477 CDD:409353 115/499 (23%)
Ig strand F 487..492 CDD:409353
FN3 <492..>737 CDD:442628
Ig strand G 500..503 CDD:409353
FN3 512..607 CDD:238020
PHA03247 <900..1248 CDD:223021
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 28/111 (25%)
Ig strand B 69..73 CDD:409353 2/3 (67%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 117..124 CDD:409353 1/6 (17%)
Ig 157..249 CDD:472250 23/91 (25%)
Ig strand B 176..180 CDD:409289 1/3 (33%)
Ig strand C 189..193 CDD:409289 0/3 (0%)
Ig strand E 213..218 CDD:409289 2/4 (50%)
Ig strand F 228..233 CDD:409289 3/4 (75%)
Ig strand G 242..245 CDD:409289 0/2 (0%)
IG_like 267..348 CDD:214653 23/107 (21%)
Ig strand C 283..287 CDD:409394 2/6 (33%)
Ig strand E 313..319 CDD:409394 1/5 (20%)
Ig strand F 329..334 CDD:409394 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.