DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Igsf9b and DIP-epsilon

DIOPT Version :9

Sequence 1:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:500 Identity:116/500 - (23%)
Similarity:177/500 - (35%) Gaps:106/500 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 SMFKAQDSLSAGKNLVPGGA---HGLREEPEF------VTARAGEGVVLRCDVIHPVTGQPPPYV 61
            |:..:.|:.|.|.....||:   :.:.|:|||      :|..||..|.|.|.|.:  .|.   |.
  Fly    23 SVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKN--LGS---YK 82

Mouse    62 VEWFKFGVPIPIFIKFGYYPPHV---DPEYAGRASLHDKAS---LRLEQVRSEDQGWYECKV--L 118
            |.|..|.....:.:.     .||   :|..:.....|||..   |.:..|:.||:|.|.|::  :
  Fly    83 VAWMHFEQSAILTVH-----NHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTV 142

Mouse   119 MLDQQYDTFHNGSWVHLTINAPPTFTET-PPQYIEAKEGGSITMTCTAFGNPKPIVTWLK-EGTL 181
            ....||      .:|.:.:  ||...:. ....|..:||.::|:.|.|.|:|:|.:.|.: :|..
  Fly   143 TAKTQY------GFVKVVV--PPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNK 199

Mouse   182 LGASAKYQVSD---GSLTVTSVSREDRGAYTCRAYS-IQGEAVHTTHLLVQGPPFIVSPPENITV 242
            :..:...:|.|   .||.:..:||...|||.|.|.: :.........:.|...|.:..|.:.:.:
  Fly   200 IVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGI 264

Mouse   243 NISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDG--------TLIIFRVKPED 299
            .|..:..|.|..||.|.:|.   ||..||.....:........|.|        .|.|..|:..|
  Fly   265 PIGFNITLECFIEANPTSLN---YWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSD 326

Mouse   300 AGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVKWNKD 364
            .|.|.||..|..|....                        .|..|:..|...:||.|..     
  Fly   327 YGNYKCVAKNPRGDMDG------------------------NIKLYMSSPPTTQPPPTTT----- 362

Mouse   365 GRPLQVEKNLGWTLMEDGSIRIEEATEEALGTYTCVPY--NTLGTMGQSAPARLVLKDPPYFTVL 427
                        ||....:    .|.|.||..|...|.  |.:|.:|:.....::.........|
  Fly   363 ------------TLRRTTT----TAAEIALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYL 411

Mouse   428 PGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHNALPS 472
            .......::.::|      .|.......|.| ||.|.|..|.:.|
  Fly   412 SNLNEIDKSKQKL------TGSSPKGFDWSK-GKSSGSHGNLMAS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273 22/79 (28%)
I-set 141..227 CDD:369462 23/91 (25%)
Ig 231..323 CDD:386229 25/99 (25%)
Ig <355..416 CDD:386229 13/62 (21%)
Ig 440..504 CDD:319273 9/32 (28%)
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 28/111 (25%)
Ig 69..139 CDD:143165 22/79 (28%)
IG_like 165..249 CDD:214653 22/83 (27%)
IGc2 172..237 CDD:197706 21/64 (33%)
IG_like 267..348 CDD:214653 23/107 (21%)
Ig 270..339 CDD:299845 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.