DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zfp810 and CG31441

DIOPT Version :9

Sequence 1:XP_011240774.1 Gene:Zfp810 / 235050 MGIID:2384563 Length:466 Species:Mus musculus
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:359 Identity:88/359 - (24%)
Similarity:146/359 - (40%) Gaps:94/359 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    29 YRDVMLETYSSLVSLGHCMAKPELIFNLEQGLGPRSTAGASVWNLSGVNKVSSLVDT---IQEND 90
            :|:..||.:.|.::....:.:.:.|.:.|............:|:.:......::.||   ::|: 
  Fly    69 FRNKCLEVHKSFMAANRKLLRKKAIVDEELDKPDVEKLQQDLWDHTDQEMCVAMADTAGLLRED- 132

Mouse    91 SRHFWQIEINSHTANEELVEVGKIDAELKIHEEIHRGAKSYECEVCLEAFYLKPQYSTKQSYHTC 155
                       |..||          :.|..|:..:..|:.|.:|         |..|::..|  
  Fly   133 -----------HNDNE----------KAKDAEDATQNEKNQEEQV---------QVQTEEVEH-- 165

Mouse   156 ENPCDCKKCREAFYPKSTLSQYQRLERGEKPHACLECGKSFYCKSHLTVHQRTHTGEKPYDCKEC 220
                    |:|..:..|.:|:                |.|      ..|.:||....|.:.|.:|
  Fly   166 --------CQEQLHNMSIISK----------------GVS------ARVPKRTKRNSKSWFCDQC 200

Mouse   221 RKAFYSKSQLNVHLRIHTGEKPYECKDCRKAFYRNSDLTVHQRTHTGEKPYECKVCRKAFYCNSQ 285
            ...|.|.:.|.:||:.|:|.||:.|..|:..:|.::::..|:..||..:||.|:.|.|       
  Fly   201 GGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSK------- 258

Mouse   286 LTVHHRTHTGEKPYECQVCNKAFYCKSQLAVHHRTHTGEKPYQCKECRKAFQCRSDLTRHQRTHT 350
                  |:.|              |.|:: ||.||||.|:|:||:.|.|||...|...:|:..||
  Fly   259 ------TYRG--------------CSSKV-VHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHT 302

Mouse   351 GERPYECPECRKAFYRKSDLTVHQRTHTGEKPYE 384
            .:|.|.|..|.:.|.|.|.||:||.|...::..|
  Fly   303 NQRKYHCEICDQWFLRSSHLTLHQSTKLHQRRAE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zfp810XP_011240774.1 KRAB 4..59 CDD:214630 6/29 (21%)
C2H2 Zn finger 133..153 CDD:275368 3/19 (16%)
C2H2 Zn finger 161..181 CDD:275368 4/19 (21%)
C2H2 Zn finger 189..209 CDD:275368 4/19 (21%)
COG5048 <199..373 CDD:227381 57/173 (33%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
C2H2 Zn finger 245..265 CDD:275368 4/19 (21%)
C2H2 Zn finger 273..293 CDD:275368 3/19 (16%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 369..392 CDD:372612 6/16 (38%)
C2H2 Zn finger 385..405 CDD:275368 88/359 (25%)
zf-H2C2_2 398..420 CDD:372612
C2H2 Zn finger 413..433 CDD:275368
C2H2 Zn finger 441..461 CDD:275368
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 4/12 (33%)
COG5048 <174..337 CDD:227381 65/213 (31%)
C2H2 Zn finger 197..217 CDD:275370 7/19 (37%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
C2H2 Zn finger 253..273 CDD:275368 10/47 (21%)
zf-H2C2_2 268..290 CDD:290200 14/21 (67%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
C2H2 Zn finger 309..328 CDD:275368 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.