DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rdh8 and CG31937

DIOPT Version :9

Sequence 1:NP_001025461.1 Gene:Rdh8 / 235033 MGIID:2685028 Length:317 Species:Mus musculus
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:199 Identity:67/199 - (33%)
Similarity:103/199 - (51%) Gaps:18/199 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 RTVLISGCSSGIGLELALQLAHDPRQRYQVVATMRDLG-----KKEPLEAAAGEALGKTLSVVQL 65
            :.|.|:|.|||||..|||.||   |...::|.:.|.|.     ::|.|.||.|....|.:.|:|:
  Fly    47 QVVWITGASSGIGRALALSLA---RHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQM 108

Mouse    66 DVCN-DESVT---DCLSHIEGGQVDVLVNNAGVGLVGPLEGLSLATMQSVFNTNFFGAVRLVKAV 126
            |:.: ||..|   ..|:|..  ::||||||||.........:.:...:.:|..:.|..|.|.:.|
  Fly   109 DMLDLDEHKTHLNTVLNHFH--RLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLV 171

Mouse   127 LPGMKRRR--QGHIVVVSSVMGLQGVMFNDVYAASKFALEGFFESLAIQLRQFNIFISMVEPGPV 189
            :.....:.  :|||...||:.|...|.|:..|.|:|.||..:..||.:::|:.:  :|:..|||:
  Fly   172 VRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLD--VSLFAPGPI 234

Mouse   190 TTDF 193
            .|||
  Fly   235 ATDF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rdh8NP_001025461.1 NADB_Rossmann 6..263 CDD:304358 67/199 (34%)
adh_short 6..201 CDD:278532 67/199 (34%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 67/199 (34%)
adh_short 47..245 CDD:278532 67/199 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.