DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEY2 and E(spl)mbeta-HLH

DIOPT Version :10

Sequence 1:NP_036391.1 Gene:HEY2 / 23493 HGNCID:4881 Length:337 Species:Homo sapiens
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:121 Identity:40/121 - (33%)
Similarity:66/121 - (54%) Gaps:14/121 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQMTVDHLKMLQA------ 105
            ||..:.::|::||.|||..|.||:.::.....::|.  .:||||:||::||:|:|.|:|      
  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRL 78

Human   106 ---TGG-KGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHL 157
               ||| ....|......:....|:.....||::.|::|.|:  |..|..:|:|||
  Fly    79 SSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGV--SVDLGTQLMSHL 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEY2NP_036391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 2/2 (100%)
bHLH-O_HEY2 40..121 CDD:381490 28/83 (34%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 47..116 28/78 (36%)
ORANGE 119..165 CDD:128787 12/39 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..337
YRPW motif 327..330
E(spl)mbeta-HLHNP_524505.2 bHLH-O_ESMB_like 7..75 CDD:381584 24/60 (40%)
ORANGE 97..141 CDD:128787 12/38 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.