DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEY2 and E(spl)mgamma-HLH

DIOPT Version :10

Sequence 1:NP_036391.1 Gene:HEY2 / 23493 HGNCID:4881 Length:337 Species:Homo sapiens
Sequence 2:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster


Alignment Length:59 Identity:19/59 - (32%)
Similarity:23/59 - (38%) Gaps:11/59 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   248 GATDPLG--AAPAPASVP-------APTPSPALAPTPTPAP-VPAPAPAPFPTPPASLT 296
            ||....|  |.|.|..:|       |.||..... |||..| ||..:...:.|...|:|
  Fly    40 GANVTAGNTATPGPGMIPGSNSSCSAKTPITTTG-TPTLQPSVPRSSQQAYTTTGGSVT 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEY2NP_036391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
bHLH-O_HEY2 40..121 CDD:381490
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 47..116
ORANGE 119..165 CDD:128787
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..337
YRPW motif 327..330
E(spl)mgamma-HLHNP_524504.2 bHLH-O_ESMB_like 9..77 CDD:381584 12/37 (32%)
ORANGE 91..135 CDD:128787 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.