DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEY2 and dpn

DIOPT Version :9

Sequence 1:NP_036391.1 Gene:HEY2 / 23493 HGNCID:4881 Length:337 Species:Homo sapiens
Sequence 2:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster


Alignment Length:336 Identity:106/336 - (31%)
Similarity:157/336 - (46%) Gaps:47/336 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    11 ESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLV 75
            ::|::...|....|.|| .|..|..|:::|...|:...||..:.|:|||||.|||:.|:||:.|:
  Fly     4 KNDINSDDDFDCSNGYS-DSYGSNGRMSNPNGLSKAELRKTNKPIMEKRRRARINHCLNELKSLI 67

Human    76 PTAFEKQGS--AKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLS 138
            ..|.:|..:  .|||||:||:|||.||:.:|.........:....:.....||.||..||.||:|
  Fly    68 LEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVS 132

Human   139 SVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAH-HHHPLHPHHWAAAFHHLPAALLQ--PN 200
            .::|:|:.  :|.||.:||:.||...|.....|:.:: :...|.|   |.|....|..|..  |.
  Fly   133 QMDGIDTG--VRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFP---ATAVTAAPTPLFPSLPQ 192

Human   201 GLHASESTPCRLSTTSEVPPA---HGSALLTATFAHADSALRMPSTGSVAPCVPPLSTSLLSLSA 262
            .|:.:       |.|....||   .|..|:.:.....:.||.||:|||.||  ||...:....:|
  Fly   193 DLNNN-------SRTESSAPAIQMGGLQLIPSRLPSGEFALIMPNTGSAAP--PPGPFAWPGSAA 248

Human   263 TVHAAAAAATAAAHSFPL---SFAGAFPM--------------LPPNAAAAVAAATAI------S 304
            .|.|..|:|..|:.:.|.   .:..:|.|              ||.|....:...|.:      |
  Fly   249 GVAAGTASAALASIANPTHLNDYTQSFRMSAFSKPVNTSVPANLPENLIHTLPGQTQLPVKNSTS 313

Human   305 PPLS-VSATSS 314
            |||| :|:.||
  Fly   314 PPLSPISSISS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEY2NP_036391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 12/40 (30%)
bHLH-O_HEY2 40..121 CDD:381490 32/82 (39%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 47..116 30/70 (43%)
ORANGE 119..165 CDD:128787 18/45 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..337 5/9 (56%)
YRPW motif 327..330
dpnNP_476923.1 HLH 39..101 CDD:238036 30/61 (49%)
ORANGE 114..158 CDD:128787 18/45 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.