DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CBX7 and HP1c

DIOPT Version :10

Sequence 1:NP_783640.1 Gene:CBX7 / 23492 HGNCID:1557 Length:251 Species:Homo sapiens
Sequence 2:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster


Alignment Length:209 Identity:58/209 - (27%)
Similarity:90/209 - (43%) Gaps:41/209 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     8 EQVFAVESIRKKRV-RKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRK 71
            |..|.||.|..||: .:|||||.:||:|:....:||||||:...|.|:..:||...:.     :|
  Fly     5 EPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESRAKS-----KK 64

Human    72 RG-PKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAP-ELVDKGPLVPT 134
            || .|||...:|:|           :|.|: ...|...:|:....|.:|.... :..|:..|||:
  Fly    65 RGEKKPKCEEIQKL-----------RGYER-GLELAEIVGATDVTGDIKYLVRWQFCDEFDLVPS 117

Human   135 LPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAG--------EWEP 191
            .....:.|:....|.    :|..|         :.|.:.::....|:.|:.|.        ...|
  Fly   118 AQIVEKDPQMLIDYF----QKMAP---------YSRHIAMRMKGVPEELRLAASRTSYPHISSAP 169

Human   192 AAQPPEEEADADLA 205
            ...|||.:..|:||
  Fly   170 VEVPPEVDQSAELA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CBX7NP_783640.1 CD_Cbx7 7..62 CDD:349293 25/54 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..220 7/16 (44%)
CBX7_C 209..240 CDD:465385
Required for cellular lifespan extension 223..236
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127 22/46 (48%)
CSD 85..135 CDD:349275 10/53 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.