DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CBX7 and Su(var)205

DIOPT Version :10

Sequence 1:NP_783640.1 Gene:CBX7 / 23492 HGNCID:1557 Length:251 Species:Homo sapiens
Sequence 2:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster


Alignment Length:109 Identity:41/109 - (37%)
Similarity:57/109 - (52%) Gaps:8/109 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     8 EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYE---EKEERDRASGY 69
            |:.:|||.|..:|||||||||.:||||:|...:|||||.::....|:..||   :.||:..||..
  Fly    21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKK 85

Human    70 RKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGS 113
            .:.....|....|...|....::.|.|.:|.     |.|.|:.|
  Fly    86 DRPSSSAKAKETQGRASSSTSTASKRKSEEP-----TAPSGNKS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CBX7NP_783640.1 CD_Cbx7 7..62 CDD:349293 27/56 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..220
CBX7_C 209..240 CDD:465385
Required for cellular lifespan extension 223..236
Su(var)205NP_476755.1 CD_HP1a_insect 24..72 CDD:349300 25/47 (53%)
CSD_HP1a_insect 146..198 CDD:349305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.