DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CES3 and alpha-Est2

DIOPT Version :9

Sequence 1:NP_079198.2 Gene:CES3 / 23491 HGNCID:1865 Length:571 Species:Homo sapiens
Sequence 2:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster


Alignment Length:568 Identity:170/568 - (29%)
Similarity:245/568 - (43%) Gaps:127/568 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    26 ATGPEVAQPEVDTTLGRVRGRQVGVKGTDRLVNVFLGIPFAQPPLGPDRFSAPHPAQPWEGVRDA 90
            :||..|.   :||..|:|||.|............|.|||:|:||:|..||.||.|.:||:||.:.
  Fly    28 STGHTVI---LDTKYGQVRGLQRKTVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNC 89

Human    91 ST--APPMCLQDVESMNSSRFVLNGKQQIFSVSEDCLVLNVYSPA---EVPAGSGRPVMVWVHGG 150
            :|  :.||          .|.:|.|   |...|||||.||||..|   |.|.    ||:||::||
  Fly    90 TTNRSKPM----------QRNMLLG---IVEGSEDCLHLNVYVKALKSEKPL----PVIVWIYGG 137

Human   151 ALITGAATSYDGSALAAYG-------DVVVVTVQYRLGVLGFFSTGDE--HAPGNQGFLDVVAAL 206
            ....|.| |.|     .|.       .||.|.:.|||..|||.|..|.  ..|||.|..|.|.||
  Fly   138 GFQKGEA-SRD-----IYSPDYFMKKPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQVMAL 196

Human   207 RWVQENIAPFGGDLNCVTVFGGSAGGSIISGLVLSPVAAGLFHRAITQSGV-----ITTPGIIDS 266
            ||:.:|||.|.||.|.:|:.|.|||.:.:..::.:....||||:||.|||.     :.:|    .
  Fly   197 RWISQNIAHFNGDPNNITLMGESAGSASVHVMMTTEQTRGLFHKAIMQSGCALSEWVESP----D 257

Human   267 HPWP--LAQ--------KIANTLACSSSSPAEMVQCLQQKEGEELVLSKKLKN--------TIYP 313
            :.|.  |||        |.|:.|:..|...|..:..:.|    :::...::::        .|.|
  Fly   258 NNWAFRLAQNLGYKGDEKDADVLSFLSKVCARQIAAIDQ----DVINLDEVRSFLLFAFGPVIEP 318

Human   314 LTVDGTVFPKSPKELLKEKPFHSVPFLMGVNNHE--FSWLIPR--GWGLLDTMEQMSREDMLAIS 374
            ...|..|.||..|:||.|...:.:|.::|.|:.|  ||:.:.|  .|.|.:....:.||   ...
  Fly   319 YETDHCVVPKRHKDLLSEAWGNDIPVIVGGNSFEGLFSYQLVRKDPWALKNFHNILPRE---VRE 380

Human   375 TPVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINVPTVSFS---------RYL- 429
            |..|...|:....:     :.|..|::.|...:.|:.      :|:    ||         |:: 
  Fly   381 TSSLEGQDLLVRRL-----KQLYFNNEMQESMEMFEA------LNI----FSHRQIWHDTHRFIL 430

Human   430 -RDS---GSPVFFYEFQHRPSSFAKIKPAWVKAD------HGAEGAFVFGGPFL--MDESSRLAF 482
             |.|   .:|.:.|.|......|.:.: ..|..|      |..|.:::|.....  :|:||.   
  Fly   431 ARQSYAPKTPTYLYRFDFDSPHFNQFR-RLVCGDRIRGVAHADELSYLFYNIIASKLDKSSM--- 491

Human   483 PEATEEEKQLSLTMMAQWTHFARTGDPNSKAL--PPWPQFNQAEQYLE 528
                 |.|.:. .|:..||.||.:|:||...|  ..|......|..:|
  Fly   492 -----EYKTIE-RMVGMWTSFASSGNPNCPELGSAKWEAVQLKENAVE 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CES3NP_079198.2 COesterase 32..547 CDD:278561 167/562 (30%)
Aes <129..>247 CDD:223730 49/129 (38%)
Prevents secretion from ER. /evidence=ECO:0000255 568..571
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 165/552 (30%)
Aes <117..>221 CDD:223730 47/113 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3612
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.