DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CES3 and CG4382

DIOPT Version :9

Sequence 1:NP_079198.2 Gene:CES3 / 23491 HGNCID:1865 Length:571 Species:Homo sapiens
Sequence 2:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster


Alignment Length:593 Identity:163/593 - (27%)
Similarity:258/593 - (43%) Gaps:113/593 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    30 EVAQPEVDTTLGRVRG----RQVGVKGTDRLVNVFLGIPFAQPPLGPDRFSAPHPAQPWEGVRDA 90
            |::...:.|.||::||    .|.|     |....|.|||:|:||:...||..|.|.:.|....||
  Fly    40 ELSDLVITTALGKIRGTILPSQSG-----RNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDA 99

Human    91 STAPPMCLQDVESMNSSRFVLNGKQQIFSVSEDCLVLNVYS---PAEVPAGSGRPVMVWVHGGAL 152
            :...|.|.|        ..:::|     .||||||.:|:|:   |:|......|||:|::|.|..
  Fly   100 TFDGPKCPQ--------LGLVSG-----DVSEDCLRVNIYTKELPSESQPNVRRPVIVFIHPGGF 151

Human   153 --ITGAATSYDGSALAAYGDVVVVTVQYRLGVLGFFSTGDEHAPGNQGFLDVVAALRWVQENIAP 215
              ::|.:.::.|........:|:||..||||.|||.:||...||||.|..|.|..||||:.:|:.
  Fly   152 YSLSGQSKNFAGPQYFMNRRLVLVTFNYRLGSLGFLATGTREAPGNMGLKDQVQLLRWVKLHISR 216

Human   216 FGGDLNCVTVFGGSAGGSIISGLVLSPVAAGLFHRAITQSGVITTPGIIDSHPWPLAQKIANTLA 280
            ||||.:.:|:.|..||...::..::||::.||||:||..||.:|....:..|...:|.|.|..|.
  Fly   217 FGGDPSSITLLGYGAGAMAVTLHMVSPMSRGLFHKAIVMSGAVTGQWSLPDHQMDVATKQATLLH 281

Human   281 CSSSSPAEMVQCLQQKEGEELVLSKKLKNTI---------YPLTV-DGTVFPKSPKE-LLKEKP- 333
            |.:.:..||:.||:.|...|..      ||:         .||.: ...:.|...:| .|.|:| 
  Fly   282 CHTENVTEMMDCLKGKHYLEFA------NTLPKMFEFDRNNPLILWKPVIEPDFGQERFLVEEPI 340

Human   334 -------FHSVPFLMGVNNHEFSWLIPRGWGLLDTMEQMSREDMLAISTPVLTSLDVPPEMMPTV 391
                   |..||.:.|:...||   :.....:|.             |..:|::|:...|.:..|
  Fly   341 RSYQNDDFMKVPIITGMTKDEF---VGPALSILQ-------------SPTLLSALNENFESLAPV 389

Human   392 IDEYLGSNSDAQAKCQAFQEFMGDVF------INVPTVSFSRYLRDS---------------GSP 435
            .  ::.:.|||:| |...||.....|      .|....:.|....|:               .:.
  Fly   390 F--FMYNTSDARA-CNISQELRNHYFPDKLIDANRSLEALSNLYSDALTGFGIHRFVHLAARSTK 451

Human   436 VFFYEFQHRPSS----FAKIKPAWVKADHGAEGAFVFGGPFLMDESSRLAFPEATEEEKQLSLTM 496
            |::|.|.::.:.    :.:..|..|.  |..:..::|..|.:    ||: |.|..:|.:.:.: |
  Fly   452 VYYYRFSYQGARSHIYYPEDAPYGVV--HHDDLMYLFVEPSI----SRM-FTEDDDEFRMVDI-M 508

Human   497 MAQWTHFARTGDPNSK---ALPP--WPQFN-QAEQYLEINPVPRAGQKFREAWMQFWSETLPSKI 555
            :..::.||..||||..   ||..  |..|: :...||:|.......:.......:.|....|   
  Fly   509 VRMFSAFAYKGDPNKPTDLALRDIRWRPFSFKKRYYLDIGKHITLEENLNAENYEIWKRLFP--- 570

Human   556 QQWHQKQK 563
            ..|.::.|
  Fly   571 LNWRRQTK 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CES3NP_079198.2 COesterase 32..547 CDD:278561 158/573 (28%)
Aes <129..>247 CDD:223730 45/122 (37%)
Prevents secretion from ER. /evidence=ECO:0000255 568..571
CG4382NP_609301.2 COesterase 41..565 CDD:278561 158/574 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142632
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11559
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.