DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SEC61G and CG8860

DIOPT Version :9

Sequence 1:NP_001012474.1 Gene:SEC61G / 23480 HGNCID:18277 Length:68 Species:Homo sapiens
Sequence 2:NP_610738.1 Gene:CG8860 / 36310 FlyBaseID:FBgn0033691 Length:68 Species:Drosophila melanogaster


Alignment Length:67 Identity:58/67 - (86%)
Similarity:63/67 - (94%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNII 65
            ||:|::|.||.|.|.||||||||||||||||||||||:|||:|||||||||||||||||||||||
  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNII 65

Human    66 VG 67
            ||
  Fly    66 VG 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SEC61GNP_001012474.1 SecE <12..68 CDD:412402 52/56 (93%)
CG8860NP_610738.1 SecE <12..68 CDD:412402 52/56 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151894
Domainoid 1 1.000 103 1.000 Domainoid score I6777
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40767
Inparanoid 1 1.050 122 1.000 Inparanoid score I4751
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53965
OrthoDB 1 1.010 - - D1623399at2759
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 1 1.000 - - otm41548
orthoMCL 1 0.900 - - OOG6_101625
Panther 1 1.100 - - O PTHR12309
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2276
SonicParanoid 1 1.000 - - X1245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.