DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CBX5 and rhi

DIOPT Version :10

Sequence 1:NP_036249.1 Gene:CBX5 / 23468 HGNCID:1555 Length:191 Species:Homo sapiens
Sequence 2:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster


Alignment Length:111 Identity:41/111 - (36%)
Similarity:65/111 - (58%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    10 DSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNL-DCPELISEFMKKYKKM 73
            |:..::..|||||||:|.:|.|.|:.:.|:||.||..|:|||||.:|: :|.:|:|:|..:..::
  Fly    14 DAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL 78

Human    74 KEGENNKPREKSESNKRKSNFSNSADDI------KSKKKREQSNDI 113
                :.|...|| ..|.||:.|:|...|      .|||.::.|..:
  Fly    79 ----HRKAAAKS-VGKSKSSPSSSGPLITENGPSSSKKTQQHSKSV 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CBX5NP_036249.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 26/49 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 13/50 (26%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302
rhiNP_536794.1 CD_Rhino 23..73 CDD:349280 26/49 (53%)
CSD 362..411 CDD:349275
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.