DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CBX5 and Cbx5

DIOPT Version :9

Sequence 1:NP_001120793.1 Gene:CBX5 / 23468 HGNCID:1555 Length:191 Species:Homo sapiens
Sequence 2:NP_001100267.1 Gene:Cbx5 / 300266 RGDID:1306619 Length:191 Species:Rattus norvegicus


Alignment Length:191 Identity:187/191 - (97%)
Similarity:190/191 - (99%) Gaps:0/191 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISE 65
            |||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||
  Rat     1 MGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISE 65

Human    66 FMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGAT 130
            |||||||||||||||||||||.|||||:|||||||||||||||||||||||||||||||||||||
  Rat    66 FMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGAT 130

Human   131 DSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS 191
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||
  Rat   131 DSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESAKS 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CBX5NP_001120793.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 47/48 (98%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 44/46 (96%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 56/56 (100%)
Cbx5NP_001100267.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 47/48 (98%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 56/56 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I39740
eggNOG 1 0.900 - - E1_KOG1911
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7257
Inparanoid 1 1.050 385 1.000 Inparanoid score I13452
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG52905
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - oto144238
orthoMCL 1 0.900 - - OOG6_104220
Panther 1 1.100 - - LDO PTHR22812
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1717.340

Return to query results.
Submit another query.