DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CBX5 and swi6

DIOPT Version :9

Sequence 1:NP_001120793.1 Gene:CBX5 / 23468 HGNCID:1555 Length:191 Species:Homo sapiens
Sequence 2:NP_593449.1 Gene:swi6 / 2541633 PomBaseID:SPAC664.01c Length:328 Species:Schizosaccharomyces pombe


Alignment Length:268 Identity:58/268 - (21%)
Similarity:95/268 - (35%) Gaps:100/268 - (37%)


- Green bases have known domain annotations that are detailed below.


Human     3 KKTKRTA---DSSSSEDEEEYVVEKVLDRRVVK--GQVEYLLKWKGFSE-EHNTWEPEKNLD-CP 60
            ||.|..|   :....|:|:||||||||..|:.:  |..||||||:|:.: ..|||..|.:.. |.
pombe    61 KKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCK 125

Human    61 ELISEFMKKY-------KKMKEGENNKPR--------EKSESNKRKSNFSNSADDIK-------- 102
            :||..:..::       |:.:.....||.        .|::.:|...:.:...:|:.        
pombe   126 QLIEAYWNEHGGRPEPSKRKRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFAD 190

Human   103 -----------------------------SKKKREQSNDI------------------------- 113
                                         |:|:..:|.||                         
pombe   191 KSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDN 255

Human   114 ----ARGFERGLEPEKIIGATDSC-----GDLMFLMKWKD---TDEADLVLAKEANVKCPQIVIA 166
                .:..|.....|.::.:.|:.     |.|...:.||:   :.....:    .|.||||.::.
pombe   256 RELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTI----TNKKCPQKMLQ 316

Human   167 FYEERLTW 174
            |||..||:
pombe   317 FYESHLTF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CBX5NP_001120793.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 24/52 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 11/127 (9%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 15/64 (23%)
swi6NP_593449.1 CHROMO 85..134 CDD:237991 19/48 (40%)
ChSh 261..326 CDD:197638 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I3903
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.