DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CBX5 and chp2

DIOPT Version :9

Sequence 1:NP_001120793.1 Gene:CBX5 / 23468 HGNCID:1555 Length:191 Species:Homo sapiens
Sequence 2:NP_596808.1 Gene:chp2 / 2540047 PomBaseID:SPBC16C6.10 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:57/224 - (25%)
Similarity:91/224 - (40%) Gaps:72/224 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    11 SSSSED---EEEYVVEKVLDRRVVK--GQVEYLLKWKGFSE-EHNTWEPEKN-LDCPELISEFMK 68
            ||.|||   :||:.||.:||.|:.|  ...:|.|||:|:.: ..|||..|:: ..|.|||..:. 
pombe   164 SSGSEDKNSDEEFAVEMILDSRMKKDGSGFQYYLKWEGYDDPSDNTWNDEEDCAGCLELIDAYW- 227

Human    69 KYKKMKEGENNKP---------REKSESNK-----RKSNFSNSADDIKSKKKREQS--------- 110
                  |....||         |.::.|:.     .|...|||.|.|..|::|.::         
pombe   228 ------ESRGGKPDLSSLIRLTRSRARSSNEASYVEKDESSNSDDSISYKRRRSRNAANRITDYV 286

Human   111 -NDIARGF--ERGLEPEKIIGATDS------------------C---------GDLMFLMKWKD- 144
             :|::...  |:..:.||.:.:..|                  |         |.|:..:|||: 
pombe   287 DSDLSESSMKEKQSKIEKYMKSDKSSKNFKPPFQKKSWEDLVDCVKTVQQLDNGKLIAKIKWKNG 351

Human   145 -TDEADLVLAKEANVKCPQIVIAFYEERL 172
             ....|.::..:   |||..:|.:||..:
pombe   352 YVSTHDNIIIHQ---KCPLKIIEYYEAHI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CBX5NP_001120793.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 20/52 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 14/70 (20%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 17/88 (19%)
chp2NP_596808.1 CHROMO 174..228 CDD:237991 21/60 (35%)
ChSh 316..380 CDD:197638 13/65 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 48 1.000 Domainoid score I3903
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.