DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEY1 and E(spl)m8-HLH

DIOPT Version :9

Sequence 1:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens
Sequence 2:NP_524513.1 Gene:E(spl)m8-HLH / 43161 FlyBaseID:FBgn0000591 Length:179 Species:Drosophila melanogaster


Alignment Length:177 Identity:45/177 - (25%)
Similarity:78/177 - (44%) Gaps:21/177 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    39 MSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVD 103
            |..||.:||. :|.::.::|::||.|:|..|..|:.||.....    :.|..:::|||:|:..|.
  Fly     1 MEYTTKTQIY-QKVKKPMLERQRRARMNKCLDNLKTLVAELRG----DDGILRMDKAEMLESAVI 60

Human   104 HLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHL----NN 164
            .::...|. .|...:..:|.:|....|:...:.||:|.::...|:  |..|...:::||    .|
  Fly    61 FMRQQKTP-KKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGM--SVDLGKSVMTHLGRVYKN 122

Human   165 YASQREAASGAH--------AGLGHIPWGTV-FGHHPHIAHPLLLPQ 202
            .....||.|.|.        :.:...|.... .|:|.....|...||
  Fly   123 LQQFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEY1NP_001035798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 5/12 (42%)
bHLH_SF 41..126 CDD:381792 23/84 (27%)
ORANGE 124..170 CDD:128787 11/49 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..238 2/3 (67%)
YRPW motif 298..301
E(spl)m8-HLHNP_524513.1 HLH 10..67 CDD:238036 16/61 (26%)
ORANGE 81..125 CDD:128787 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.