DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEY1 and E(spl)m5-HLH

DIOPT Version :10

Sequence 1:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:93 Identity:23/93 - (24%)
Similarity:47/93 - (50%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    51 KRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKG 115
            |.::.::|::||.|:|..|..|:.|| :.|:.   :....:::|||:|:..   |..:.....|.
  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLV-AEFQG---DDAILRMDKAEMLEAA---LVFMRKQVVKQ 77

Human   116 YFDAHALAMDYRSLGFRECLAEVARYLS 143
            ......|.||....|:...::|::|.::
  Fly    78 QAPVSPLPMDSFKNGYMNAVSEISRVMA 105

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity