DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEY1 and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:266 Identity:64/266 - (24%)
Similarity:103/266 - (38%) Gaps:98/266 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    50 RKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQVMEQGS--AKLEKAEILQMTVDHLKMLH--- 109
            ||..:.::|::||.|||..|.||:.::...    :.::|.  .:||||:||::||:|:|.|.   
  Fly    14 RKVMKPMLERKRRARINKCLDELKDIMVEC----LTQEGEHITRLEKADILELTVEHMKKLRAQK 74

Human   110 -------TAGGKGYFDAH-ALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYA 166
                   |.|.....|.. ::|..:|: |:.....||::.|:.:.|:  |..|..:|:|||    
  Fly    75 QLRLSSVTGGVSPSADPKLSIAESFRA-GYVHAANEVSKTLAAVPGV--SVDLGTQLMSHL---- 132

Human   167 SQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAP 231
                                                 ||                ||.......|
  Fly   133 -------------------------------------GH----------------RLNYLQV
VVP 144

Human   232 ALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGK 296
            :|   |.|.  |:...|...:.::||           |....|   |...|.|| ||::|::...
  Fly   145 SL---PIGV--PLQAPVEDQAMVTPP-----------PSECDS---LESGACSP-APSEASSTSG 189

Human   297 P-YRPW 301
            | :|||
  Fly   190 PMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEY1NP_001035798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 1/1 (100%)
bHLH_SF 41..126 CDD:381792 27/88 (31%)
ORANGE 124..170 CDD:128787 12/45 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..238 6/37 (16%)
YRPW motif 298..301 1/2 (50%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 23/64 (36%)
ORANGE 97..141 CDD:128787 16/103 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140876
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.