DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEY1 and h

DIOPT Version :9

Sequence 1:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens
Sequence 2:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster


Alignment Length:370 Identity:84/370 - (22%)
Similarity:130/370 - (35%) Gaps:140/370 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    31 NLSSALGSM--------SPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQVMEQ 87
            |:::.||:.        :|..|.    |:..:.|:|||||.||||.|:||:.|:..|.:|.....
  Fly     9 NMTNVLGTAVVPAQLKETPLKSD----RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARH 69

Human    88 GSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASD 152
              :|||||:||:.||.||:.|..........|....::....||.:|:.||:|:    .|::.:.
  Fly    70 --SKLEKADILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRF----PGIEPAQ 128

Human   153 PLRVRLVSHLNN---------YASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNA 208
              |.||:.||:|         :..||:                   ......|..:||       
  Fly   129 --RRRLLQHLSNCINGVKTELHQQQRQ-------------------QQQQSIHAQMLP------- 165

Human   209 GTTASPTEPHHQGRLGSAHP-------EAPALRAP----------PSGSLGPVLP---------- 246
               :.|:.|....:.|:|.|       .|.....|          |:||:..|||          
  Fly   166 ---SPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQQ 227

Human   247 -----------------VVTSASKLSPPLLS--------------SVASLSAFPFSFGSFHLLSP 280
                             ...:|::..|.|:|              |.|...:.|.|..|.....|
  Fly   228 LLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPP 292

Human   281 NA---------LSPS----APTQAANLG-----------KPYRPW 301
            :.         :.||    .|.:...|.           :|:|||
  Fly   293 SPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEY1NP_001035798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 6/28 (21%)
bHLH_SF 41..126 CDD:381792 32/84 (38%)
ORANGE 124..170 CDD:128787 14/54 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..238 9/54 (17%)
YRPW motif 298..301 1/2 (50%)
hNP_001014577.1 HLH 29..88 CDD:238036 29/64 (45%)
ORANGE 106..141 CDD:128787 13/40 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.