Sequence 1: | NP_001035798.1 | Gene: | HEY1 / 23462 | HGNCID: | 4880 | Length: | 308 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014577.1 | Gene: | h / 38995 | FlyBaseID: | FBgn0001168 | Length: | 337 | Species: | Drosophila melanogaster |
Alignment Length: | 370 | Identity: | 84/370 - (22%) |
---|---|---|---|
Similarity: | 130/370 - (35%) | Gaps: | 140/370 - (37%) |
- Green bases have known domain annotations that are detailed below.
Human 31 NLSSALGSM--------SPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQVMEQ 87
Human 88 GSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASD 152
Human 153 PLRVRLVSHLNN---------YASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNA 208
Human 209 GTTASPTEPHHQGRLGSAHP-------EAPALRAP----------PSGSLGPVLP---------- 246
Human 247 -----------------VVTSASKLSPPLLS--------------SVASLSAFPFSFGSFHLLSP 280
Human 281 NA---------LSPS----APTQAANLG-----------KPYRPW 301 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HEY1 | NP_001035798.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..52 | 6/28 (21%) | |
bHLH_SF | 41..126 | CDD:381792 | 32/84 (38%) | ||
ORANGE | 124..170 | CDD:128787 | 14/54 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 200..238 | 9/54 (17%) | |||
YRPW motif | 298..301 | 1/2 (50%) | |||
h | NP_001014577.1 | HLH | 29..88 | CDD:238036 | 29/64 (45%) |
ORANGE | 106..141 | CDD:128787 | 13/40 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |