DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ANGPTL2 and CG9500

DIOPT Version :9

Sequence 1:NP_036230.1 Gene:ANGPTL2 / 23452 HGNCID:490 Length:493 Species:Homo sapiens
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:261 Identity:90/261 - (34%)
Similarity:135/261 - (51%) Gaps:42/261 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   238 STNEIQ---SDQNLKVL----PPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVK 295
            ||..||   ||.|...|    |...||.|           |:           .|..|..:..:|
  Fly    57 STENIQKSSSDLNTTGLSGRYPSQCPTYP-----------PA-----------HGIYTVQVLGLK 99

Human   296 PENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQ 360
            |      .||.||......||||:.||....:||||:|..||.|||.:||::::||:.::.:|..
  Fly   100 P------FQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKS 158

Human   361 GNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKL-RLGRYHGNAGDSFTWHNGKQFTTLDRDHD 424
            ..::|.:.:||:.|:..:|.|....:|.|:::|.: :||.:.|:||||...:..:.|:|.|||:|
  Fly   159 QPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDND 223

Human   425 VYTGNCAHYQKGGWWYNACAHSNLNGVWYRG--GHYRSRYQ-DGVYWAEFRGGSYSLKKVVMMIR 486
            .:..|||....|.||:..|.:|||.|::.:|  |.|   :| .|:.|..:|..|||.|.:.||:|
  Fly   224 GWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQY---FQWKGIVWHSWRTESYSYKVMQMMVR 285

Human   487 P 487
            |
  Fly   286 P 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ANGPTL2NP_036230.1 FReD 273..487 CDD:238040 75/217 (35%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 82/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3350
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.