powered by:
Protein Alignment ATP1B4 and GABA-B-R1
DIOPT Version :9
Sequence 1: | NP_001135919.1 |
Gene: | ATP1B4 / 23439 |
HGNCID: | 808 |
Length: | 357 |
Species: | Homo sapiens |
Sequence 2: | NP_001246033.1 |
Gene: | GABA-B-R1 / 34878 |
FlyBaseID: | FBgn0260446 |
Length: | 841 |
Species: | Drosophila melanogaster |
Alignment Length: | 44 |
Identity: | 14/44 - (31%) |
Similarity: | 20/44 - (45%) |
Gaps: | 3/44 - (6%) |
- Green bases have known domain annotations that are detailed below.
Human 25 DEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEKEEEEEEEK 68
|:|...|..|.....|:|.| ..|...|.||.::...::|||
Fly 738 DKAESKYNPDSAISKEDEER---YQKLVTENEELQRLITQKEEK 778
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3927 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.